YPEL2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YPEL2_HUMAN
• UniProt AC: Q96QA6
• Protein Name: Protein yippee-like 2
• Gene Name: YPEL2
• Organism: Homo sapiens (Human).
• Sequence Length: 119
• Subcellular Localization: Nucleus, nucleolus .
• Protein Sequence: MVKMTRSKTFQAYLPSCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKYIIELAHMIKDNGWD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
49	Phosphorylation	QGSQGRAYLFNSVVN CCCCHHEEEECCEEE	15.51	28387310
69	Phosphorylation	AEERVLLTGLHAVAD HHHHHHHHHHHHHEE	33.27	28387310
90	Phosphorylation	KTTLGWKYEHAFESS CCCCCCCCEECHHCC	13.36	22817900
100	Phosphorylation	AFESSQKYKEGKYII CHHCCHHHHCCCCHH	13.46	18083107
105	Phosphorylation	QKYKEGKYIIELAHM HHHHCCCCHHHHHHH	20.28	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YPEL2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YPEL2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YPEL2_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of YPEL2_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.