YP010_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YP010_YEAST
• UniProt AC: A5Z2X5
• Protein Name: UPF0495 protein YPR010C-A
• Gene Name: YPR010C-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 72
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MRPAQLLLNTAKKTSGGYKIPVELTPLFLAVGVALCSGTYFTYKKLRTDETLRLTGNPELSSLDEVLAKDKD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
61	Phosphorylation	LTGNPELSSLDEVLA CCCCCCCCCHHHHHH	27.48	30377154
62	Phosphorylation	TGNPELSSLDEVLAK CCCCCCCCHHHHHHH	53.09	30377154
69	Acetylation	SLDEVLAKDKD---- CHHHHHHHCCC----	62.24	24489116
71	Acetylation	DEVLAKDKD------ HHHHHHCCC------	65.71	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YP010_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YP010_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YP010_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YP010_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.