YOO8_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YOO8_SCHPO
• UniProt AC: O94293
• Protein Name: Uncharacterized protein C887.08
• Gene Name: SPBC887.08
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 124
• Protein Sequence: MDLLAIDLDFDVSESKLERNKRLKQKVSIETDGWTPRVQCFGHLSKNGVVLGEEAYILEQSKFAAEEQYYLGNYSLAKKFAFQALDVPTDSSSIEYHRLSSGEINEIEDIIRRCEMKLENKQSN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
89	Phosphorylation	FQALDVPTDSSSIEY CCCCCCCCCCCCEEE	48.65	29996109
91	Phosphorylation	ALDVPTDSSSIEYHR CCCCCCCCCCEEEEE	28.59	25720772
92	Phosphorylation	LDVPTDSSSIEYHRL CCCCCCCCCEEEEEC	37.84	25720772
93	Phosphorylation	DVPTDSSSIEYHRLS CCCCCCCCEEEEECC	24.32	29996109
96	Phosphorylation	TDSSSIEYHRLSSGE CCCCCEEEEECCCCC	7.20	25720772
100	Phosphorylation	SIEYHRLSSGEINEI CEEEEECCCCCCCHH	35.93	25720772
101	Phosphorylation	IEYHRLSSGEINEIE EEEEECCCCCCCHHH	45.07	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YOO8_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YOO8_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YOO8_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DUS4_SCHPO	SPCC777.15	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.