UniProt ID | YOO8_SCHPO | |
---|---|---|
UniProt AC | O94293 | |
Protein Name | Uncharacterized protein C887.08 | |
Gene Name | SPBC887.08 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 124 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MDLLAIDLDFDVSESKLERNKRLKQKVSIETDGWTPRVQCFGHLSKNGVVLGEEAYILEQSKFAAEEQYYLGNYSLAKKFAFQALDVPTDSSSIEYHRLSSGEINEIEDIIRRCEMKLENKQSN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
89 | Phosphorylation | FQALDVPTDSSSIEY CCCCCCCCCCCCEEE | 48.65 | 29996109 | |
91 | Phosphorylation | ALDVPTDSSSIEYHR CCCCCCCCCCEEEEE | 28.59 | 25720772 | |
92 | Phosphorylation | LDVPTDSSSIEYHRL CCCCCCCCCEEEEEC | 37.84 | 25720772 | |
93 | Phosphorylation | DVPTDSSSIEYHRLS CCCCCCCCEEEEECC | 24.32 | 29996109 | |
96 | Phosphorylation | TDSSSIEYHRLSSGE CCCCCEEEEECCCCC | 7.20 | 25720772 | |
100 | Phosphorylation | SIEYHRLSSGEINEI CEEEEECCCCCCCHH | 35.93 | 25720772 | |
101 | Phosphorylation | IEYHRLSSGEINEIE EEEEECCCCCCCHHH | 45.07 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YOO8_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YOO8_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YOO8_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DUS4_SCHPO | SPCC777.15 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...