dbPTM

YOH7_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YOH7_SCHPO
UniProt AC	Q9P6R3
Protein Name	Uncharacterized protein C13E7.07
Gene Name	SPBC13E7.07
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	273
Subcellular Localization	Cytoplasm . Membrane Single-pass membrane protein .
Protein Description
Protein Sequence	MGYEEAFFRWAFLIATVYVAYYFLVSSDKKLATKPQKSKLTKLGKQKQRQKQKNTKKDTLVNRETPSKKSQKLETSDALKSKSKDSSKKEPVVVPKKGTPKIFQENHKVKKVKSPKKEKLVGKNPAEKEDTTDVEDTQKLEQKHSTTPSSLKMKSSISLAAITADDSLHNSFSSNDIDDGFQTVTSSRSYGKKKSTEPLTKRQRQNQQKKLRAKEMQELADEEQRRRLAAHRKELHEANRPRGGLNNSSRSAYSYINNGQAGSSKGNRYDSLW

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
59	Phosphorylation	QKNTKKDTLVNRETP HHHCHHHHHHCCCCC	41.29	21712547
65	Phosphorylation	DTLVNRETPSKKSQK HHHHCCCCCCHHHHH	29.62	21712547
67	Phosphorylation	LVNRETPSKKSQKLE HHCCCCCCHHHHHCH	61.20	24763107
114	Phosphorylation	HKVKKVKSPKKEKLV CCCEECCCCCHHHCC	44.96	21712547
131	Phosphorylation	NPAEKEDTTDVEDTQ CHHCCCCCCCHHHHH	26.45	29996109
132	Phosphorylation	PAEKEDTTDVEDTQK HHCCCCCCCHHHHHH	50.82	25720772
146	Phosphorylation	KLEQKHSTTPSSLKM HHHHHHCCCHHHHHC	42.31	21712547
147	Phosphorylation	LEQKHSTTPSSLKMK HHHHHCCCHHHHHCC	24.96	24763107
149	Phosphorylation	QKHSTTPSSLKMKSS HHHCCCHHHHHCCCC	46.33	21712547
150	Phosphorylation	KHSTTPSSLKMKSSI HHCCCHHHHHCCCCC	32.96	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YOH7_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YOH7_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YOH7_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YOH7_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YOH7_SCHPO

Related Literatures of Post-Translational Modification