YN11A_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YN11A_YEAST
• UniProt AC: Q12391
• Protein Name: Transposon Ty1-NL1 Gag polyprotein
• Gene Name: TY1A-NL1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 440
• Subcellular Localization: Cytoplasm.
• Protein Description: Capsid protein (CA) is the structural component of the virus-like particle (VLP), forming the shell that encapsulates the retrotransposons dimeric RNA genome. The particles are assembled from trimer-clustered units and there are holes in the capsid shells that allow for the diffusion of macromolecules. CA has also nucleocapsid-like chaperone activity, promoting primer tRNA(i)-Met annealing to the multipartite primer-binding site (PBS), dimerization of Ty1 RNA and initiation of reverse transcription (By similarity)..
• Protein Sequence: MESQQLSQHSPISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQTAQSHSPQNGPYQQQCMMTQNQANPSGWSFYGRPSMIPYTPYQMSPMYFPPGPHSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPNDFLNWVKTYIKFLQNSNLGDIIPTATRKAVRQMTDDELTFLCHTFQLFAPSQFLPTWVKDILSADYTDIMKILSKSINKMQSDTQEVNDITTLATLHYNGSTPADAFEAEVTNILDRLNNNGIPINNKVACQFIMRGLSGEYKFLRYARHRYIHMTVADLFSDIHSMYEEQQESKRNKSTYRRNPSDEKKDSRTYTNTTKPKSITRNSQKPNNSQSRTARAHNVSTSNNSSGPDNDLIRGSTTEPIQLKNKHDLHLRPGTY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MESQQLSQHS -----CCCCCHHCCC	23.17	22369663
7	Phosphorylation	-MESQQLSQHSPISH -CCCCCHHCCCCCCC	22.85	22369663
10	Phosphorylation	SQQLSQHSPISHGSA CCCHHCCCCCCCHHH	19.11	22369663
13	Phosphorylation	LSQHSPISHGSACAS HHCCCCCCCHHHCCC	25.77	22369663
16	Phosphorylation	HSPISHGSACASVTS CCCCCCHHHCCCCCC	18.10	22369663
20	Phosphorylation	SHGSACASVTSKEVH CCHHHCCCCCCCCCC	26.30	22369663
22	Phosphorylation	GSACASVTSKEVHTN HHHCCCCCCCCCCCC	31.42	22369663
23	Phosphorylation	SACASVTSKEVHTNQ HHCCCCCCCCCCCCC	25.35	22369663
24	Ubiquitination	ACASVTSKEVHTNQD HCCCCCCCCCCCCCC	55.16	24961812
28	Phosphorylation	VTSKEVHTNQDPLDV CCCCCCCCCCCCCCC	39.49	28889911
36	Phosphorylation	NQDPLDVSASKIQEY CCCCCCCCHHHHHHH	26.88	25521595
38	Phosphorylation	DPLDVSASKIQEYDK CCCCCCHHHHHHHHH	23.84	25521595
39	Ubiquitination	PLDVSASKIQEYDKA CCCCCHHHHHHHHHH	48.39	24961812
43	Phosphorylation	SASKIQEYDKASTKA CHHHHHHHHHHHCCC	13.33	22890988
45	Ubiquitination	SKIQEYDKASTKANS HHHHHHHHHHCCCCC	43.25	15699485
47	Phosphorylation	IQEYDKASTKANSQQ HHHHHHHHCCCCCCC	35.86	25533186
48	Phosphorylation	QEYDKASTKANSQQT HHHHHHHCCCCCCCC	38.75	22890988
71	Phosphorylation	PENPHHASPQTAQSH CCCCCCCCCCCHHHC	17.12	28889911
74	Phosphorylation	PHHASPQTAQSHSPQ CCCCCCCCHHHCCCC	30.01	28889911
79	Phosphorylation	PQTAQSHSPQNGPYQ CCCHHHCCCCCCCHH	33.17	21082442
145	Phosphorylation	GTPLSTPSPESGNTF CCCCCCCCCCCCCCC	41.19	28889911
157	Phosphorylation	NTFTDSSSADSDMTS CCCCCCCCCCCCCCC	39.79	28889911
160	Phosphorylation	TDSSSADSDMTSTKK CCCCCCCCCCCCCCC	29.06	16445868
318	Phosphorylation	QFIMRGLSGEYKFLR HHHHCCCCCHHHHHH	32.19	20377248
322	Ubiquitination	RGLSGEYKFLRYARH CCCCCHHHHHHHHHH	33.35	23749301
371	Phosphorylation	PSDEKKDSRTYTNTT CCCCCCCCCCCCCCC	35.09	28889911
377	Phosphorylation	DSRTYTNTTKPKSIT CCCCCCCCCCCCCCC	28.53	28889911
382	Phosphorylation	TNTTKPKSITRNSQK CCCCCCCCCCCCCCC	37.41	21440633
405	Phosphorylation	ARAHNVSTSNNSSGP HHHHCCCCCCCCCCC	31.06	28889911
420	Phosphorylation	DNDLIRGSTTEPIQL CCCCCCCCCCCCEEC	23.47	22369663
421	Phosphorylation	NDLIRGSTTEPIQLK CCCCCCCCCCCEECC	37.69	22369663
422	Phosphorylation	DLIRGSTTEPIQLKN CCCCCCCCCCEECCC	41.27	22369663
439	Phosphorylation	DLHLRPGTY------ CCCCCCCCC------	28.83	17287358
440	Phosphorylation	LHLRPGTY------- CCCCCCCC-------	23.60	19779198

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YN11A_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YN11A_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YN11A_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YN11A_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.