dbPTM

YMRF1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YMRF1_YEAST
UniProt AC	P03881
Protein Name	Uncharacterized mitochondrial protein RF1
Gene Name	Q0255
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	472
Subcellular Localization	Mitochondrion .
Protein Description
Protein Sequence	MIKWTMINIYLLLMFLIIKNNNNNNNYNNITKYNKDMDLYSIQSPYIKNMNIIKRGYHTSLNNKLIIVQKDNKNNNKNNLEMDNFYKWLVGFTDGDGSFYIKLNDKKYLRFFYGFRMHIDDKACLEKIRNMLNMPSNFEETTKTIMLVNSQKKWLYSNIVTIFDKYPCLTIKYYSYYKWKMAMINNLNGMSYNNKDLLNIKNTINNYEVMPNLKIPYDKMNDYWILGFIEAEGSFDTSPKRNICGFNVSQHKRSINTLKAIKSYVLNNWKPIDNTPLLIKNKLLKDWDSSIKLTKPDKNGVIKLEFNRMDFLYYVILPKLYSLKWYSRKEIDFQLWKTTMEIYMKGLHNTTKGSNLLKLINNNINKKRYYSNYNISKNIIDDVLNMNTIYNYKLPYRMNSDIQRLNSMNNNNTKFINVGVFVYDLNNTLIMTFTGYRPAATYFNCSKHEIAKYIKNGNVFMNKYILKNILLD

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	Phosphorylation	---MIKWTMINIYLL ---CCCHHHHHHHHH	11.81	28889911
10	Phosphorylation	KWTMINIYLLLMFLI CHHHHHHHHHHHHHH	6.19	28889911
57	Phosphorylation	MNIIKRGYHTSLNNK CCCCCCCEECCCCCE	13.12	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YMRF1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YMRF1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YMRF1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YMRF1_YEAST !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YMRF1_YEAST

Related Literatures of Post-Translational Modification