YLAT1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YLAT1_MOUSE
• UniProt AC: Q9Z1K8
• Protein Name: Y+L amino acid transporter 1
• Gene Name: Slc7a7
• Organism: Mus musculus (Mouse).
• Sequence Length: 510
• Subcellular Localization: Basolateral cell membrane; Multi-pass membrane protein.
• Protein Description: Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Requires coexpression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine. Plays a role in nitric oxide synthesis via transport of L-arginine, and is involved in the transport of L-arginine in monocytes..
• Protein Sequence: MVNSTKYEVAAQHEADDGSALGDGASPVAEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSASFGLSLVIWAVGGIFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFANYMVQPLFPSCGAPYAAGRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIIAGIVRLGQGATANFENSFEGSSFAMGDIALALYSALFSYSGWDTLNYVTEEIRNPERNLPLSIGISMPIVTIIYLLTNVAYYSVLDIKEILASDAVAVTFADQIFGVFNWIIPVAVAFSCFGGLNASIVAASRLLFVGSREGHLPDAICMVHVERFTPVPSLLFNGVLSLVYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKDPDRPRPLKLSLFFPIIFCLCTIFLVAVPLYSDTINSLIGIGIALSGLPFYFFIIRVPEHKRPLFLRRIVASITRYLQILCMSVAAEMDLEDGELSKQDPKSK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	N-linked_Glycosylation	-----MVNSTKYEVA -----CCCCCCHHHC	42.54	-
4	Phosphorylation	----MVNSTKYEVAA ----CCCCCCHHHCC	18.18	21082442
6	Ubiquitination	--MVNSTKYEVAAQH --CCCCCCHHHCCEE	38.95	22790023
7	Phosphorylation	-MVNSTKYEVAAQHE -CCCCCCHHHCCEEC	18.74	19144319
19	Phosphorylation	QHEADDGSALGDGAS EECCCCCCCCCCCCC	27.58	27087446
26	Phosphorylation	SALGDGASPVAEQVK CCCCCCCCCHHHHHH	25.99	26745281
326	N-linked_Glycosylation	FSCFGGLNASIVAAS HHCCCCCCHHHHHHH	34.61	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YLAT1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YLAT1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YLAT1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of YLAT1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.