dbPTM

YL358_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YL358_YEAST
UniProt AC	O13565
Protein Name	Uncharacterized protein YLR358C
Gene Name	YLR358C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	187
Subcellular Localization
Protein Description
Protein Sequence	MRNGKILCCHCFYNKGDHEDDEGGRSIESLCAVNLAEGLNPRTNGPGKDSFSFSTSGSKPSSSLSFPVTSSMVSSTSSYSSFLFLLVVNHLFSGRLRCGSPEFIIRSFTITLGPLNHNISPFVFFHGNISSLPDLLVWLCRSVRCKTSTFLVIEIGKTNEEAASIIILPKLPLDACDVKSSIIVGIL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
78	Phosphorylation	SMVSSTSSYSSFLFL HHCCCCCCCHHHHHH	29.17	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YL358_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YL358_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YL358_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YL358_YEAST !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YL358_YEAST

Related Literatures of Post-Translational Modification