| UniProt ID | YK67_SCHPO | |
|---|---|---|
| UniProt AC | Q9US11 | |
| Protein Name | Uncharacterized protein C607.07c | |
| Gene Name | SPAC607.07c | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 143 | |
| Subcellular Localization |
Golgi apparatus membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MGTFGIVALSIICSIAFLFVAYGVLRLINSIRRRNMMTADVSSVKSSQTWNFLKNPFSNSAKFEALDADDMWDTRVEEAELNTIPSASPFIDHTSETVPFVNTEAPPPRLSSSFSRQSGENAETQSQVSASPFNDKNSPYVQE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 46 | Phosphorylation | ADVSSVKSSQTWNFL CCHHHCCCHHHHHHH | 26.06 | 24763107 | |
| 47 | Phosphorylation | DVSSVKSSQTWNFLK CHHHCCCHHHHHHHH | 26.38 | 21712547 | |
| 49 | Phosphorylation | SSVKSSQTWNFLKNP HHCCCHHHHHHHHCC | 25.07 | 21712547 | |
| 86 | Phosphorylation | AELNTIPSASPFIDH HHHCCCCCCCCCCCC | 37.21 | 29996109 | |
| 88 | Phosphorylation | LNTIPSASPFIDHTS HCCCCCCCCCCCCCC | 25.36 | 29996109 | |
| 111 | Phosphorylation | EAPPPRLSSSFSRQS CCCCCCCCCCCCCCC | 25.80 | 28889911 | |
| 112 | Phosphorylation | APPPRLSSSFSRQSG CCCCCCCCCCCCCCC | 39.74 | 29996109 | |
| 113 | Phosphorylation | PPPRLSSSFSRQSGE CCCCCCCCCCCCCCC | 24.70 | 25720772 | |
| 115 | Phosphorylation | PRLSSSFSRQSGENA CCCCCCCCCCCCCCC | 31.21 | 25720772 | |
| 118 | Phosphorylation | SSSFSRQSGENAETQ CCCCCCCCCCCCCCC | 47.14 | 28889911 | |
| 124 | Phosphorylation | QSGENAETQSQVSAS CCCCCCCCCCCCCCC | 30.98 | 29996109 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YK67_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YK67_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YK67_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of YK67_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
