dbPTM

YK18_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YK18_SCHPO
UniProt AC	Q9HDY2
Protein Name	Meiotically up-regulated protein PB1A10.08
Gene Name	SPAPB1A10.08
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	416
Subcellular Localization	Cytoplasm . Barrier septum.
Protein Description	May have a role in meiosis and sporulation..
Protein Sequence	MMTRMELRPLEIGFSKALTEVAPVTCQCECWDHNLCSSQASEMDLIYQSQDTHSCASKQDAVFQLLSETKIPVPNRYRKISHRLSTLSNKKTLKSQLDRFLSSSKKLHNDDVNRGDYCFLLSTPVECSASTNSHSYDCLWNFSCNSFPEYSSYSASETSSVASYSYYSGPNPATPSSSSCNLVNANSLDIYLNINNLKKSKSVPRLRGQFMEPVEHNHPLSKSLEEQSSFLEQSKDASSNLTACNRSGSSLSSNFYSSRLSKKTSLASLNKSRASLQHKIMSLSRNIIRRVFHKPEVHLDPSASILNLSSSHGESNLTNGLLCQNFKLFQDDWLMEDCAPDANFTLYTPLQPWEKRSVKPEIRRPRLNPNFFRVFVLEAQMRRAGKLSANTAGRAQLIYLPKPAVTFSTSPLHVEL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
223	Phosphorylation	HNHPLSKSLEEQSSF CCCCCCHHHHHHHHH	37.32	28889911
229	Phosphorylation	KSLEEQSSFLEQSKD HHHHHHHHHHHHCCC	33.28	24763107
249	Phosphorylation	TACNRSGSSLSSNFY EECCCCCCCCHHCHH	29.38	25720772
250	Phosphorylation	ACNRSGSSLSSNFYS ECCCCCCCCHHCHHH	35.48	25720772
253	Phosphorylation	RSGSSLSSNFYSSRL CCCCCCHHCHHHHCC	35.93	25720772
265	Phosphorylation	SRLSKKTSLASLNKS HCCCCHHCHHHHCHH	30.71	24763107
268	Phosphorylation	SKKTSLASLNKSRAS CCHHCHHHHCHHHHH	37.46	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YK18_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YK18_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YK18_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YK18_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YK18_SCHPO

Related Literatures of Post-Translational Modification