YJNK_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YJNK_SCHPO
• UniProt AC: Q9P7I6
• Protein Name: Uncharacterized oxidoreductase C24B10.20
• Gene Name: SPCC24B10.20
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 254
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Sequence: MSAAGGIVYVIVGGNRGIGLSLVKELSNKEGVTVFASARGPGSASELKDWSKTHSNVHIIKLDVTSLRSAKDAAMQVEKVVKCIDVLWVNSGISKSFQPVLKTSDELWMSHYQTNVLGPIHVYQAFYHLLKEGKLKNIVFTSSMAACMGGVRPNTYSAYGQSKAALNYTMKEISFELEKDGFVVVSIHPGVVNTDMFVNAMQKLASKYPEMVESIKSNAISPEQSASSMLKIVDNLKTEDNGMFYNLDGTKLPF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSAAGGIVY ------CCCCCCEEE	27.16	21712547
9	Phosphorylation	SAAGGIVYVIVGGNR CCCCCEEEEEECCCC	5.20	21712547
21	Phosphorylation	GNRGIGLSLVKELSN CCCCEEHHHHHHHCC	26.38	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YJNK_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YJNK_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YJNK_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YJNK_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.