dbPTM

YJN2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YJN2_SCHPO
UniProt AC	Q9P7K3
Protein Name	Uncharacterized kinase C24B10.02c
Gene Name	SPCC24B10.02c
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	449
Subcellular Localization	Cytoplasm . Nucleus .
Protein Description
Protein Sequence	MATKVEEINKLKKKNLHFRQCSADSLSNSSMQFDLSGLNTPVGELATSNLPSPAHPPFGELHQESRTSNSSAMHIENVVASRLMYNEVANGSFALEPKNILVVTKPRKHSLVYKTAEITKYILTIGTPETKVYVDMRLARSKRFSAHNIAKEANTDIDRIKYWNPYICLIKPSIFDLAITIGDNSTLLYTSWLFQKIGPPVLSFSDDDVPGFLTHFSLSNYQQHLYQVLTQNVSLRFCSRLQCSFHKYDEKTKQYSLASTTYSLDEILISRGEHPFISNLNVYNNSELMTVVQADGLVVATPTGSTNISANAGGSLVHPALNAILVTPVCPHTLSFRPIILPDYNVLNVEIPLDSRSSAFFSVDRHESVEMHRGDYLSIVTSHYPFTTIQNPGYQWTKVLEDKFNWNVRERQKPFSRKPSLSDVKDTSDDKFDITDNSYCREFSADIDG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
256	Phosphorylation	DEKTKQYSLASTTYS CHHCCEEEEEEEEEE	18.24	19547744
260	Phosphorylation	KQYSLASTTYSLDEI CEEEEEEEEEEHHHH	24.93	19547744
270	Phosphorylation	SLDEILISRGEHPFI EHHHHHHCCCCCCCE	30.68	19547744
416	Phosphorylation	RERQKPFSRKPSLSD HHCCCCCCCCCCHHH	48.17	21712547
420	Phosphorylation	KPFSRKPSLSDVKDT CCCCCCCCHHHCCCC	43.47	28889911
422	Phosphorylation	FSRKPSLSDVKDTSD CCCCCCHHHCCCCCC	44.70	24763107

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YJN2_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YJN2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YJN2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YJN2_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YJN2_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-420, AND MASSSPECTROMETRY.	18257517 [Abstract]