UniProt ID | YJ9S_YEAST | |
---|---|---|
UniProt AC | P47181 | |
Protein Name | Uncharacterized protein YJR154W | |
Gene Name | YJR154W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 346 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MNTDSHNLSEPYNIGGQKYINMKKKEDLGVCQPGLTQKAFTVEDKFDYKAIIEKMEVYGLCVVKNFIETSRCDEILKEIEPHFYRYESWQGSPFPKETTVATRSVLHSSTVLKDVVCDRMFCDISKHFLNEENYFAAGKVINKCTSDIQLNSGIVYKVGAGASDQGYHREDIVHHTTHQACERFQYGTETMVGLGVAFTDMNKENGSTRMIVGSHLWGPHDSCGNFDKRMEFHVNVAKGDAVLFLGSLYHAASANRTSQDRVAGYFFMTKSYLKPEENLHLGTDLRVFKGLPLEALQLLGLGISEPFCGHIDYKSPGHLISSSLFENDIEKGYYGETIRVNYGSTQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
12 | Phosphorylation | SHNLSEPYNIGGQKY CCCCCCCCCCCCHHE | 18.50 | 28132839 | |
92 | Phosphorylation | RYESWQGSPFPKETT EECCCCCCCCCCCCC | 14.31 | 22369663 | |
323 | Phosphorylation | PGHLISSSLFENDIE CCCEEECHHHCCCCC | 30.22 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YJ9S_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YJ9S_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YJ9S_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YJ9S_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...