YJ9S_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YJ9S_YEAST
• UniProt AC: P47181
• Protein Name: Uncharacterized protein YJR154W
• Gene Name: YJR154W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 346
• Subcellular Localization: Cytoplasm .
• Protein Sequence: MNTDSHNLSEPYNIGGQKYINMKKKEDLGVCQPGLTQKAFTVEDKFDYKAIIEKMEVYGLCVVKNFIETSRCDEILKEIEPHFYRYESWQGSPFPKETTVATRSVLHSSTVLKDVVCDRMFCDISKHFLNEENYFAAGKVINKCTSDIQLNSGIVYKVGAGASDQGYHREDIVHHTTHQACERFQYGTETMVGLGVAFTDMNKENGSTRMIVGSHLWGPHDSCGNFDKRMEFHVNVAKGDAVLFLGSLYHAASANRTSQDRVAGYFFMTKSYLKPEENLHLGTDLRVFKGLPLEALQLLGLGISEPFCGHIDYKSPGHLISSSLFENDIEKGYYGETIRVNYGSTQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
12	Phosphorylation	SHNLSEPYNIGGQKY CCCCCCCCCCCCHHE	18.50	28132839
92	Phosphorylation	RYESWQGSPFPKETT EECCCCCCCCCCCCC	14.31	22369663
323	Phosphorylation	PGHLISSSLFENDIE CCCEEECHHHCCCCC	30.22	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YJ9S_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YJ9S_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YJ9S_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YJ9S_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.