dbPTM

YJ87_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YJ87_SCHPO
UniProt AC	Q12519
Protein Name	Uncharacterized MFS-type transporter C330.07c
Gene Name	SPCC330.07c
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	500
Subcellular Localization	Golgi apparatus . Membrane Multi-pass membrane protein . Barrier septum. Cell tip.
Protein Description
Protein Sequence	MEPSQRSGSFSSISRRRSRVDSRPTYFKVTSKDLGFVDQVSEEYEFYTYPKKASEVESVTETFQSNRSSLVPTYPVDENANKLPPKVSIAFILINSLMSDMSLAVALPTSASYTQSLGGTNAFSGLVIGIPTLISLIFLYPMLCFANPKSANGYTLYFRPMVVSSFAHIFGHLLYCMAYRANWIYLILIGRMLNGIGFTTFLYHKKYTTDKLLVGQNRRTFLATMNILAQTLGFMAGPFLGGILAKATIHSKNAVWNQYTVASWVMLFMWFFYMLTIIFFFKEVTADKSEKVSQQKENDDEDRPKLSWKHKFLLFFLAEVAFIAYFTVNGYQASISIYTGKLYNYDAFQSGNFIALSALIVAPFILASSFLSRWLEDRHIMLGGLFLGILAVAIHLVLDAVHKLPMQVYFFLYSLMIYGYSIGSAPLISLSSKQLHPRHHNTASIVVQVGVSLSNTFGSICGGAIYNITTVGFISLCLGLAAVVYMQLIFMWGSLKCKTH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MEPSQRSGSFSSIS -CCCCCCCCCCCHHH	31.02	29996109
9	Phosphorylation	EPSQRSGSFSSISRR CCCCCCCCCCHHHCC	24.17	28889911
11	Phosphorylation	SQRSGSFSSISRRRS CCCCCCCCHHHCCCC	28.58	25720772
12	Phosphorylation	QRSGSFSSISRRRSR CCCCCCCHHHCCCCC	23.67	25720772
14	Phosphorylation	SGSFSSISRRRSRVD CCCCCHHHCCCCCCC	22.98	25720772
18	Phosphorylation	SSISRRRSRVDSRPT CHHHCCCCCCCCCCC	34.54	25720772
22	Phosphorylation	RRRSRVDSRPTYFKV CCCCCCCCCCCEEEE	36.98	29996109
26	Phosphorylation	RVDSRPTYFKVTSKD CCCCCCCEEEEECCC	12.23	25720772
54	Phosphorylation	YTYPKKASEVESVTE ECCCCCHHHCCHHHH	51.56	25720772
58	Phosphorylation	KKASEVESVTETFQS CCHHHCCHHHHHHHH	39.24	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YJ87_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YJ87_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YJ87_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YJ87_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YJ87_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-9, AND MASSSPECTROMETRY.	18257517 [Abstract]