YJ14_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YJ14_SCHPO
• UniProt AC: O94245
• Protein Name: UPF0300 protein C737.04
• Gene Name: SPCC737.04
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 421
• Subcellular Localization: Cytoplasm .
• Protein Sequence: MSISNQSGLDILREVDDEGQENSFLRKTTRKIQQFFKSDPGYQSRKAEYNSPAKATGDVNINVTSQDWLSKLDRNLSIENLTGKSLGIVVVSGRNKGLIKNPFLGGLVDIVMRRQDKLYLKSVEQVSSEYSPMQEQVYEFKVDMPLVQKRLGAFLKKNRVDGLSLSMHFSTGNYSLPVLIRHVLLYDYYTDDMKDSLWRAMIIYVSRQVTSNKYTKFHLWCVQKRIGNIRMYLVRPGDVYSFQGQTSWAAICNKSYMCNIQLEQSPEVSVKSSLPKYSNEPIFQSKTISQEEVGWLLFMLSIGNHARAFPIQNYLANTVMETVLPVELRCPFLSRSVDCEIFQKNTKRRVMEKWRQEFKKDLNVCEELEFKNVKKSGYMQPLFDLTMPLGCFDSLETKEMFYLRHNIAGFQADLTPYPMRI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSISNQSGL ------CCCCCCCCC	34.42	21712547
4	Phosphorylation	----MSISNQSGLDI ----CCCCCCCCCHH	22.85	21712547
77	Phosphorylation	SKLDRNLSIENLTGK HHCCCCCCCCCCCCC	31.26	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YJ14_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YJ14_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YJ14_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YJ14_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.