| UniProt ID | YIPF6_HUMAN | |
|---|---|---|
| UniProt AC | Q96EC8 | |
| Protein Name | Protein YIPF6 | |
| Gene Name | YIPF6 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 236 | |
| Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein . Evenly distributed between cis- and trans-Golgi apparatus (PubMed:27999994). Mainly localizes within medial-/trans-Golgi and trans-Golgi network (TGN), while less so within cis-Golgi (PubMed:28 |
|
| Protein Description | May be required for stable YIPF1 and YIPF2 protein expression.. | |
| Protein Sequence | MAEAEESPGDPGTASPRPLFAGLSDISISQDIPVEGEITIPMRSRIREFDSSTLNESVRNTIMRDLKAVGKKFMHVLYPRKSNTLLRDWDLWGPLILCVTLALMLQRDSADSEKDGGPQFAEVFVIVWFGAVTITLNSKLLGGNISFFQSLCVLGYCILPLTVAMLICRLVLLADPGPVNFMVRLFVVIVMFAWSIVASTAFLADSQPPNRRALAVYPVFLFYFVISWMILTFTPQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAEAEESPG ------CCCCCCCCC | 25.38 | 22223895 | |
| 7 | Phosphorylation | -MAEAEESPGDPGTA -CCCCCCCCCCCCCC | 26.20 | 29255136 | |
| 7 (in isoform 2) | Phosphorylation | - | 26.20 | 25849741 | |
| 13 | Phosphorylation | ESPGDPGTASPRPLF CCCCCCCCCCCCCCC | 29.38 | 29255136 | |
| 15 | Phosphorylation | PGDPGTASPRPLFAG CCCCCCCCCCCCCCC | 22.68 | 29255136 | |
| 15 (in isoform 2) | Phosphorylation | - | 22.68 | 25849741 | |
| 24 | Phosphorylation | RPLFAGLSDISISQD CCCCCCCCCCEECCC | 31.79 | 27499020 | |
| 27 | Phosphorylation | FAGLSDISISQDIPV CCCCCCCEECCCCCC | 22.60 | 27499020 | |
| 29 | Phosphorylation | GLSDISISQDIPVEG CCCCCEECCCCCCCC | 18.27 | 28348404 | |
| 51 | Phosphorylation | SRIREFDSSTLNESV HHHHCCCCCCCCHHH | 30.46 | 21815630 | |
| 52 | Phosphorylation | RIREFDSSTLNESVR HHHCCCCCCCCHHHH | 38.46 | 21815630 | |
| 53 | Phosphorylation | IREFDSSTLNESVRN HHCCCCCCCCHHHHH | 37.24 | 28857561 | |
| 55 | N-linked_Glycosylation | EFDSSTLNESVRNTI CCCCCCCCHHHHHHH | 39.32 | UniProtKB CARBOHYD | |
| 67 | Ubiquitination | NTIMRDLKAVGKKFM HHHHHHHHHHHHHHH | 45.36 | 29967540 | |
| 144 | N-linked_Glycosylation | NSKLLGGNISFFQSL CCHHHCCCCHHHHHH | 25.57 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YIPF6_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YIPF6_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YIPF6_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of YIPF6_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
