UniProt ID | YIF1B_MOUSE | |
---|---|---|
UniProt AC | Q9CX30 | |
Protein Name | Protein YIF1B | |
Gene Name | Yif1b | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 311 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MHATGLAAPAGTPRLRKWPSKRRVPVSQPGMADPHQFFDDTSSAPSRGYGGQPSPGGLGYPPSSSDAAFLAAPMSNMAMVYGSSLAAQGKELVDKNIDRFIPVSKLKYYFAVDTVYVGKKLGLLVFPYLHQDWEVQYQQDTPVAPRFDINAPDLYIPAMAFITYILVAGLALGTQDRFSPDLLGLQASSALAWLTLEVVAILLSLYLVTVNTDLTTIDLVAFLGYKYVGMIGGVLTGLLFGKIGYYLVLAWCCVSIFVFMIRTLRLKILAQAAAEGVPVRGARNQLRMYLTMAVAAAQPVLMYWLTFHLVR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MHATGLAA -------CCCCCCCC | 4.35 | 17242355 | |
4 (in isoform 2) | Phosphorylation | - | 20.32 | 29514104 | |
4 | Phosphorylation | ----MHATGLAAPAG ----CCCCCCCCCCC | 20.32 | 29514104 | |
12 | Phosphorylation | GLAAPAGTPRLRKWP CCCCCCCCCCCCCCC | 13.82 | 23527152 | |
12 (in isoform 2) | Phosphorylation | - | 13.82 | 26824392 | |
17 (in isoform 2) | Phosphorylation | - | 68.96 | 23984901 | |
20 | Phosphorylation | PRLRKWPSKRRVPVS CCCCCCCCCCCCCCC | 37.37 | 24719451 | |
27 | O-linked_Glycosylation | SKRRVPVSQPGMADP CCCCCCCCCCCCCCH | 25.29 | 46148317 | |
54 | Phosphorylation | RGYGGQPSPGGLGYP CCCCCCCCCCCCCCC | 28.43 | 25338131 | |
64 | Phosphorylation | GLGYPPSSSDAAFLA CCCCCCCCCHHHHHH | 37.70 | - | |
65 | Ubiquitination | LGYPPSSSDAAFLAA CCCCCCCCHHHHHHC | 35.29 | 27667366 | |
75 | Ubiquitination | AFLAAPMSNMAMVYG HHHHCCCCCHHHHHC | 23.53 | 27667366 | |
87 | Ubiquitination | VYGSSLAAQGKELVD HHCHHHHHCCHHHHH | 24.77 | 27667366 | |
92 | Ubiquitination | LAAQGKELVDKNIDR HHHCCHHHHHCCCCC | 7.42 | 27667366 | |
95 | Ubiquitination | QGKELVDKNIDRFIP CCHHHHHCCCCCEEE | 48.61 | 22790023 | |
97 | Ubiquitination | KELVDKNIDRFIPVS HHHHHCCCCCEEEHH | 5.04 | 27667366 | |
102 | Ubiquitination | KNIDRFIPVSKLKYY CCCCCEEEHHHCCEE | 22.93 | 27667366 | |
105 | Ubiquitination | DRFIPVSKLKYYFAV CCEEEHHHCCEEEEE | 49.59 | 22790023 | |
119 | Ubiquitination | VDTVYVGKKLGLLVF EEEEECCCHHHEEEE | 34.48 | 22790023 | |
120 | Ubiquitination | DTVYVGKKLGLLVFP EEEECCCHHHEEEEC | 41.69 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YIF1B_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YIF1B_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YIF1B_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YIF1B_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...