YH007_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YH007_YEAST
• UniProt AC: Q07074
• Protein Name: Uncharacterized protein YHR007C-A
• Gene Name: YHR007C-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 71
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MHRKKRKKEKKRTEKDNTTNLPPLFLFPCSLSLPTLLAPVHYIPTRLTHHQAENQLFLLLFQPIIVKPLRS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	KRTEKDNTTNLPPLF HCCCCCCCCCCCCEE	27.48	28889911
19	Phosphorylation	RTEKDNTTNLPPLFL CCCCCCCCCCCCEEC	40.80	28889911
30	Phosphorylation	PLFLFPCSLSLPTLL CEECEECCCCHHHHH	22.64	28889911
35	Phosphorylation	PCSLSLPTLLAPVHY ECCCCHHHHHCCCHH	39.43	28889911
42	Phosphorylation	TLLAPVHYIPTRLTH HHHCCCHHCCCCCCC	14.61	28889911
45	Phosphorylation	APVHYIPTRLTHHQA CCCHHCCCCCCCCHH	28.84	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YH007_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YH007_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YH007_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YH007_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.