| UniProt ID | YGW2_SCHPO | |
|---|---|---|
| UniProt AC | O43073 | |
| Protein Name | UPF0220 protein C8D2.02c | |
| Gene Name | pi063, SPBC8D2.02c | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 170 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MTLLDSSIFRFRLSSLHVSSRSLGVYFAGIMFASAVWVFVDAALYSAFDYARNLHITFIDWIPFLCSILGIVIVNSIDKSRLSGDSFAYTDESLARKARFILFIGFALLAGGLGGSFTVFILKYVVAGYEGKSLLMGSANIISNILFMISATALWITGNMNDDYHYNLQL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YGW2_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YGW2_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YGW2_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of YGW2_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
