dbPTM

YGRB_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YGRB_SCHPO
UniProt AC	Q9Y7X7
Protein Name	GRIP and coiled-coil domain-containing protein C365.11
Gene Name	SPBC365.11
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	266
Subcellular Localization	Cytoplasm .
Protein Description
Protein Sequence	METTVSAKNSLENENFLKEKSETVFLDEAAITKPPASKKKRKNRKKKKNNGPSEQFVGNNDLEEQRSGSIDSKDKEKPLDEKVKELENANKTLSDLVRRIQIQRDEAEQKAEIYNRDALNTKQEHLDIKKRLEKSDETVCKLKEENENLQDMLRNVGNELVESRDEIKELIEKQKVQKESVKSHESELSSVMSSEILPKASSDSAGSFEPPVISNISKELINKEYARNVLLQFLENHEHRDKILPILSTALDLEEVHQHLILKNLN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----METTVSAKNSL ----CCCCCCCCHHH	10.12	29996109
6	Phosphorylation	--METTVSAKNSLEN --CCCCCCCCHHHCC	31.28	24763107
10	Phosphorylation	TTVSAKNSLENENFL CCCCCCHHHCCCCCC	36.03	28889911
67	Phosphorylation	NDLEEQRSGSIDSKD CCHHHHHHCCCCCCC	36.26	21712547
69	Phosphorylation	LEEQRSGSIDSKDKE HHHHHHCCCCCCCCC	25.19	21712547
72	Phosphorylation	QRSGSIDSKDKEKPL HHHCCCCCCCCCCCH	40.87	21712547
183	Phosphorylation	VQKESVKSHESELSS CCHHHHHHCHHHHHH	30.26	24763107
189	Phosphorylation	KSHESELSSVMSSEI HHCHHHHHHHHHCCC	19.48	19547744
190	Phosphorylation	SHESELSSVMSSEIL HCHHHHHHHHHCCCC	34.17	19547744
193	Phosphorylation	SELSSVMSSEILPKA HHHHHHHHCCCCCCC	23.74	19547744
194	Phosphorylation	ELSSVMSSEILPKAS HHHHHHHCCCCCCCC	15.57	24763107
201	Phosphorylation	SEILPKASSDSAGSF CCCCCCCCCCCCCCC	40.58	25720772
202	Phosphorylation	EILPKASSDSAGSFE CCCCCCCCCCCCCCC	40.21	28889911
204	Phosphorylation	LPKASSDSAGSFEPP CCCCCCCCCCCCCCC	36.16	28889911
207	Phosphorylation	ASSDSAGSFEPPVIS CCCCCCCCCCCCHHH	26.59	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YGRB_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YGRB_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YGRB_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YGRB_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YGRB_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-10; SER-202 AND SER-204,AND MASS SPECTROMETRY.	18257517 [Abstract]