YGR4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YGR4_SCHPO
• UniProt AC: Q9Y7Y3
• Protein Name: Uncharacterized RNA-binding protein C365.04c
• Gene Name: SPBC365.04c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 233
• Subcellular Localization: Nucleus, nucleolus .
• Protein Sequence: MSSKLSKKKLKSLEYRSKKFDKKSQSLEEHEKKVQQKNEELEKKAADKISRDELPEKQLAQSNDKDKHSVSNPPHKTLKSKRQKGKNNDRKVILFVGNLPKDSSVETLQLHFKRAGQVPSVRIPTDKTSGRQKGYAFVEFINPKTDVISKALKFHHTIYKERKINIELTAGGGGKTEARMNKIKEKNRKWKEEMRQRVASEEQQAGEEKMARKAVADEGLESGIHPDRLRLLQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
200	Phosphorylation	EMRQRVASEEQQAGE HHHHHHHHHHHHHHH	38.52	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YGR4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YGR4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YGR4_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YGR4_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.