dbPTM

YG1B_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YG1B_SCHPO
UniProt AC	O94695
Protein Name	Putative transporter C83.11
Gene Name	SPBC83.11
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	449
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description
Protein Sequence	MVLRERLSHILFHEKVGFLLLCLLWYISSAVTNTTSKSIFNELRCPVTLTFLQFGFVAFFSAVCLLFRKQFLGGTGIQKPSKYVLYTTLPLSIFQIGGHVFGSLATTKIPVSTVHTVKALSPLFTVLAYRFMFRHVYSAMTYFSLVPLTFGVTLACSFELSADIVGLLYALISTCIFVSQNIFGSKIFMEAKSHSTHTKKHYNKLNLLLYSSGVAFIVMIPVWLYQEGFAYLPEVGSPVFLNLIYNGLSHFFQNILAFTLLSIISPVAYSIASLIKRIFVIVVSIIWFQQATNFTQGSGIFLTAIGLWLYDRSKKGNLYESCKVKEFEKDALELEEQTMEDEKSYPSSGTQSPFYGKNFLPQITPRLDSVVPLISDSPMTPNSVYSNEGVTSSVSGNATPASVRQSTQNDFSNSNIHDRRSSYTFQLNNFKAPQPSRLWATETVPTLKI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
193	Phosphorylation	KIFMEAKSHSTHTKK CHHHHHHHCCCCCHH	4.03	21712547
344	Phosphorylation	QTMEDEKSYPSSGTQ HHHCCCCCCCCCCCC	13.84	24763107
347	Phosphorylation	EDEKSYPSSGTQSPF CCCCCCCCCCCCCCC	55.10	25720772
348	Phosphorylation	DEKSYPSSGTQSPFY CCCCCCCCCCCCCCC	5.60	28889911
350	Phosphorylation	KSYPSSGTQSPFYGK CCCCCCCCCCCCCCC	36.14	24763107
352	Phosphorylation	YPSSGTQSPFYGKNF CCCCCCCCCCCCCCC	6.40	28889911
355	Phosphorylation	SGTQSPFYGKNFLPQ CCCCCCCCCCCCCCC	5.26	28889911
364	Phosphorylation	KNFLPQITPRLDSVV CCCCCCCCCCCCCCE	12.93	25720772
421	Phosphorylation	SNIHDRRSSYTFQLN CCCCCCCCCEEEEEC	34.46	29996109
422	Phosphorylation	NIHDRRSSYTFQLNN CCCCCCCCEEEEECC	40.72	29996109
424	Phosphorylation	HDRRSSYTFQLNNFK CCCCCCEEEEECCCC	10.46	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YG1B_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YG1B_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YG1B_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YG1B_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YG1B_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-333; SER-337 ANDTYR-340, AND MASS SPECTROMETRY.	18257517 [Abstract]