UniProt ID | YG1B_SCHPO | |
---|---|---|
UniProt AC | O94695 | |
Protein Name | Putative transporter C83.11 | |
Gene Name | SPBC83.11 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 449 | |
Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MVLRERLSHILFHEKVGFLLLCLLWYISSAVTNTTSKSIFNELRCPVTLTFLQFGFVAFFSAVCLLFRKQFLGGTGIQKPSKYVLYTTLPLSIFQIGGHVFGSLATTKIPVSTVHTVKALSPLFTVLAYRFMFRHVYSAMTYFSLVPLTFGVTLACSFELSADIVGLLYALISTCIFVSQNIFGSKIFMEAKSHSTHTKKHYNKLNLLLYSSGVAFIVMIPVWLYQEGFAYLPEVGSPVFLNLIYNGLSHFFQNILAFTLLSIISPVAYSIASLIKRIFVIVVSIIWFQQATNFTQGSGIFLTAIGLWLYDRSKKGNLYESCKVKEFEKDALELEEQTMEDEKSYPSSGTQSPFYGKNFLPQITPRLDSVVPLISDSPMTPNSVYSNEGVTSSVSGNATPASVRQSTQNDFSNSNIHDRRSSYTFQLNNFKAPQPSRLWATETVPTLKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
193 | Phosphorylation | KIFMEAKSHSTHTKK CHHHHHHHCCCCCHH | 4.03 | 21712547 | |
344 | Phosphorylation | QTMEDEKSYPSSGTQ HHHCCCCCCCCCCCC | 13.84 | 24763107 | |
347 | Phosphorylation | EDEKSYPSSGTQSPF CCCCCCCCCCCCCCC | 55.10 | 25720772 | |
348 | Phosphorylation | DEKSYPSSGTQSPFY CCCCCCCCCCCCCCC | 5.60 | 28889911 | |
350 | Phosphorylation | KSYPSSGTQSPFYGK CCCCCCCCCCCCCCC | 36.14 | 24763107 | |
352 | Phosphorylation | YPSSGTQSPFYGKNF CCCCCCCCCCCCCCC | 6.40 | 28889911 | |
355 | Phosphorylation | SGTQSPFYGKNFLPQ CCCCCCCCCCCCCCC | 5.26 | 28889911 | |
364 | Phosphorylation | KNFLPQITPRLDSVV CCCCCCCCCCCCCCE | 12.93 | 25720772 | |
421 | Phosphorylation | SNIHDRRSSYTFQLN CCCCCCCCCEEEEEC | 34.46 | 29996109 | |
422 | Phosphorylation | NIHDRRSSYTFQLNN CCCCCCCCEEEEECC | 40.72 | 29996109 | |
424 | Phosphorylation | HDRRSSYTFQLNNFK CCCCCCEEEEECCCC | 10.46 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YG1B_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YG1B_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YG1B_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YG1B_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...