UniProt ID | YG12A_YEAST | |
---|---|---|
UniProt AC | Q12485 | |
Protein Name | Transposon Ty1-GR2 Gag polyprotein | |
Gene Name | TY1A-GR2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 440 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Capsid protein (CA) is the structural component of the virus-like particle (VLP), forming the shell that encapsulates the retrotransposons dimeric RNA genome. The particles are assembled from trimer-clustered units and there are holes in the capsid shells that allow for the diffusion of macromolecules. CA has also nucleocapsid-like chaperone activity, promoting primer tRNA(i)-Met annealing to the multipartite primer-binding site (PBS), dimerization of Ty1 RNA and initiation of reverse transcription (By similarity).. | |
Protein Sequence | MESQQLSQHSHISHGSACASVTSKEVHTNQDPLDVSASKIQEYDKASTKANSQQTTTPASSAVPENPHHASPQPASVPPPQNGPYPQQCMMTQNQANPSGWSFYGHPSMIPYTPYQMSPMYFPPGPQSQFPQYPSSVGTPLSTPSPESGNTFTDSSSADSDMTSTKKYVRPPPMLTSPNDFPNWVKTYIKFLQNSNLGGIIPTVNGKPVRQITDDELTFLYNTFQIFAPSQFLPTWVKDILSVDYTDIMKILSKSIEKMQSDTQEANDIVTLANLQYNGSTPADAFETKVTNIIDRLNNNGIHINNKVACQLIMRGLSGEYKFLRYTRHRHLNMTVAELFLDIHAIYEEQQGSRNSKPNYRRNPSDEKNDSRSYTNTTKPKVIARNPQKTNNSKSKTARAHNVSTSNNSPSTDNDSISKSTTEPIQLNNKHDLHLRPGTY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
3 | Phosphorylation | -----MESQQLSQHS -----CCCCCHHHCC | 23.17 | 23607784 | |
7 | Phosphorylation | -MESQQLSQHSHISH -CCCCCHHHCCCCCC | 22.85 | 23607784 | |
10 | Phosphorylation | SQQLSQHSHISHGSA CCCHHHCCCCCCCCC | 18.19 | 24909858 | |
13 | Phosphorylation | LSQHSHISHGSACAS HHHCCCCCCCCCCCC | 19.17 | 24909858 | |
16 | Phosphorylation | HSHISHGSACASVTS CCCCCCCCCCCCCCC | 18.10 | 23607784 | |
20 | Phosphorylation | SHGSACASVTSKEVH CCCCCCCCCCCCCCC | 26.30 | 28889911 | |
22 | Phosphorylation | GSACASVTSKEVHTN CCCCCCCCCCCCCCC | 31.42 | 28889911 | |
23 | Phosphorylation | SACASVTSKEVHTNQ CCCCCCCCCCCCCCC | 25.35 | 19823750 | |
24 | Ubiquitination | ACASVTSKEVHTNQD CCCCCCCCCCCCCCC | 55.16 | 17644757 | |
28 | Phosphorylation | VTSKEVHTNQDPLDV CCCCCCCCCCCCCCC | 39.49 | 28889911 | |
36 | Phosphorylation | NQDPLDVSASKIQEY CCCCCCCCHHHHHHH | 26.88 | 25521595 | |
38 | Phosphorylation | DPLDVSASKIQEYDK CCCCCCHHHHHHHHH | 23.84 | 25521595 | |
39 | Ubiquitination | PLDVSASKIQEYDKA CCCCCHHHHHHHHHH | 48.39 | 24961812 | |
43 | Phosphorylation | SASKIQEYDKASTKA CHHHHHHHHHHHCCC | 13.33 | 22890988 | |
45 | Ubiquitination | SKIQEYDKASTKANS HHHHHHHHHHCCCCC | 43.25 | 15699485 | |
47 | Phosphorylation | IQEYDKASTKANSQQ HHHHHHHHCCCCCCC | 35.86 | 25533186 | |
48 | Phosphorylation | QEYDKASTKANSQQT HHHHHHHCCCCCCCC | 38.75 | 22890988 | |
71 | Phosphorylation | PENPHHASPQPASVP CCCCCCCCCCCCCCC | 21.51 | 28889911 | |
145 | Phosphorylation | GTPLSTPSPESGNTF CCCCCCCCCCCCCCC | 41.19 | 28889911 | |
157 | Phosphorylation | NTFTDSSSADSDMTS CCCCCCCCCCCCCCC | 39.79 | 28889911 | |
160 | Phosphorylation | TDSSSADSDMTSTKK CCCCCCCCCCCCCCC | 29.06 | 16445868 | |
166 | Ubiquitination | DSDMTSTKKYVRPPP CCCCCCCCCCCCCCC | 41.70 | 15699485 | |
167 | Ubiquitination | SDMTSTKKYVRPPPM CCCCCCCCCCCCCCC | 49.41 | 17644757 | |
176 | Phosphorylation | VRPPPMLTSPNDFPN CCCCCCCCCCCCCCH | 35.57 | 17330950 | |
177 | Phosphorylation | RPPPMLTSPNDFPNW CCCCCCCCCCCCCHH | 20.11 | 17330950 | |
186 | Ubiquitination | NDFPNWVKTYIKFLQ CCCCHHHHHHHHHHH | 27.50 | 17644757 | |
190 | Ubiquitination | NWVKTYIKFLQNSNL HHHHHHHHHHHHCCC | 29.61 | 17644757 | |
203 | Phosphorylation | NLGGIIPTVNGKPVR CCCCEEECCCCEECE | 19.05 | 24909858 | |
207 | Ubiquitination | IIPTVNGKPVRQITD EEECCCCEECEECCH | 34.83 | 23749301 | |
238 | Ubiquitination | QFLPTWVKDILSVDY HHCCHHHHHHHCCCH | 30.52 | 15699485 | |
250 | Ubiquitination | VDYTDIMKILSKSIE CCHHHHHHHHHHHHH | 40.61 | 24961812 | |
255 | Phosphorylation | IMKILSKSIEKMQSD HHHHHHHHHHHHHHC | 32.38 | 21440633 | |
261 | Phosphorylation | KSIEKMQSDTQEAND HHHHHHHHCCHHHHH | 38.84 | 28132839 | |
263 | Phosphorylation | IEKMQSDTQEANDIV HHHHHHCCHHHHHHH | 33.29 | 28132839 | |
280 | Phosphorylation | ANLQYNGSTPADAFE HHCEECCCCHHHHHH | 27.81 | 28889911 | |
281 | Phosphorylation | NLQYNGSTPADAFET HCEECCCCHHHHHHH | 24.72 | 27214570 | |
289 | Ubiquitination | PADAFETKVTNIIDR HHHHHHHHHHHHHHH | 39.60 | 17644757 | |
307 | Ubiquitination | NGIHINNKVACQLIM CCCCCCHHHHHHHHH | 27.07 | 17644757 | |
318 | Phosphorylation | QLIMRGLSGEYKFLR HHHHCCCCCCHHHHH | 32.19 | 21440633 | |
322 | Ubiquitination | RGLSGEYKFLRYTRH CCCCCCHHHHHHHHH | 33.35 | 23749301 | |
353 | Phosphorylation | IYEEQQGSRNSKPNY HHHHHCCCCCCCCCC | 24.77 | 28889911 | |
357 | Ubiquitination | QQGSRNSKPNYRRNP HCCCCCCCCCCCCCC | 40.61 | 22817900 | |
365 | Phosphorylation | PNYRRNPSDEKNDSR CCCCCCCCCCCCCCC | 63.05 | 28889911 | |
371 | Phosphorylation | PSDEKNDSRSYTNTT CCCCCCCCCCCCCCC | 32.30 | 17287358 | |
373 | Phosphorylation | DEKNDSRSYTNTTKP CCCCCCCCCCCCCCC | 40.02 | 25521595 | |
374 | Phosphorylation | EKNDSRSYTNTTKPK CCCCCCCCCCCCCCE | 11.69 | 22890988 | |
375 | Phosphorylation | KNDSRSYTNTTKPKV CCCCCCCCCCCCCEE | 27.60 | 21551504 | |
377 | Phosphorylation | DSRSYTNTTKPKVIA CCCCCCCCCCCEEEE | 28.53 | 22890988 | |
378 | Phosphorylation | SRSYTNTTKPKVIAR CCCCCCCCCCEEEEC | 47.63 | 22890988 | |
379 | Ubiquitination | RSYTNTTKPKVIARN CCCCCCCCCEEEECC | 40.58 | 22817900 | |
381 | Ubiquitination | YTNTTKPKVIARNPQ CCCCCCCEEEECCCC | 48.07 | 22817900 | |
397 | Phosphorylation | TNNSKSKTARAHNVS CCCCCCCCHHHCCCC | 28.59 | 21551504 | |
404 | Phosphorylation | TARAHNVSTSNNSPS CHHHCCCCCCCCCCC | 31.28 | 25533186 | |
405 | Phosphorylation | ARAHNVSTSNNSPST HHHCCCCCCCCCCCC | 31.06 | 25533186 | |
406 | Phosphorylation | RAHNVSTSNNSPSTD HHCCCCCCCCCCCCC | 26.89 | 21551504 | |
409 | Phosphorylation | NVSTSNNSPSTDNDS CCCCCCCCCCCCCCC | 25.20 | 17330950 | |
411 | Phosphorylation | STSNNSPSTDNDSIS CCCCCCCCCCCCCCC | 48.49 | 17330950 | |
412 | Phosphorylation | TSNNSPSTDNDSISK CCCCCCCCCCCCCCC | 42.05 | 17330950 | |
416 | Phosphorylation | SPSTDNDSISKSTTE CCCCCCCCCCCCCCC | 34.71 | 21551504 | |
418 | Phosphorylation | STDNDSISKSTTEPI CCCCCCCCCCCCCCE | 25.22 | 25533186 | |
419 | Ubiquitination | TDNDSISKSTTEPIQ CCCCCCCCCCCCCEE | 50.59 | 23749301 | |
420 | Phosphorylation | DNDSISKSTTEPIQL CCCCCCCCCCCCEEC | 33.50 | 24909858 | |
421 | Phosphorylation | NDSISKSTTEPIQLN CCCCCCCCCCCEECC | 38.63 | 28889911 | |
422 | Phosphorylation | DSISKSTTEPIQLNN CCCCCCCCCCEECCC | 47.02 | 21551504 | |
430 | Ubiquitination | EPIQLNNKHDLHLRP CCEECCCCCCCCCCC | 37.11 | 24961812 | |
439 | Phosphorylation | DLHLRPGTY------ CCCCCCCCC------ | 28.83 | 17287358 | |
440 | Phosphorylation | LHLRPGTY------- CCCCCCCC------- | 23.60 | 19779198 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YG12A_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YG12A_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YG12A_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YG12A_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...