YFS2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YFS2_SCHPO
• UniProt AC: Q1K9B6
• Protein Name: Uncharacterized protein C19D5.02c
• Gene Name: SPAC19D5.02c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 223
• Subcellular Localization: Endoplasmic reticulum membrane ; Single-pass membrane protein . Localizes to the nuclear rim.
• Protein Sequence: MLGQGLIFISLAFVAHALEIPISCAVSHNEQTEIFPHGTIDIPEMTFRPSDSQIDWSNLSHSDFVQCGVYEDSTNTWLAGASKYKIDEIKTLPKVPRDHYIILCDSSESNEIAKFTQVVHSFDFSSDSESAVVEQLHPSSPIPILTTAVRKKGSRPSKPQKEKQGNKQGSKTEESPNVDEDELESEPEEKTFFQKYGLYLIPILFLIIMSGNNANQQAANTAK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
58	N-linked_Glycosylation	DSQIDWSNLSHSDFV CCCCCCCCCCCCCCE	41.11	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YFS2_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YFS2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YFS2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AGO1_SCHPO	ago1	genetic	18818364
ZDS1_SCHPO	zds1	genetic	18818364
ASL1_SCHPO	asl1	genetic	22681890
SEC7B_SCHPO	sec72	genetic	22681890
RICTR_SCHPO	ste20	genetic	22681890
YE98_SCHPO	erp2	genetic	22681890
ATP11_SCHPO	atp11	genetic	22681890
GMA12_SCHPO	gma12	genetic	22681890
OMH6_SCHPO	omh6	genetic	22681890
RRP1_SCHPO	nop52	genetic	22681890

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.