UniProt ID | YFS2_SCHPO | |
---|---|---|
UniProt AC | Q1K9B6 | |
Protein Name | Uncharacterized protein C19D5.02c | |
Gene Name | SPAC19D5.02c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 223 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass membrane protein . Localizes to the nuclear rim. |
|
Protein Description | ||
Protein Sequence | MLGQGLIFISLAFVAHALEIPISCAVSHNEQTEIFPHGTIDIPEMTFRPSDSQIDWSNLSHSDFVQCGVYEDSTNTWLAGASKYKIDEIKTLPKVPRDHYIILCDSSESNEIAKFTQVVHSFDFSSDSESAVVEQLHPSSPIPILTTAVRKKGSRPSKPQKEKQGNKQGSKTEESPNVDEDELESEPEEKTFFQKYGLYLIPILFLIIMSGNNANQQAANTAK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
58 | N-linked_Glycosylation | DSQIDWSNLSHSDFV CCCCCCCCCCCCCCE | 41.11 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YFS2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YFS2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YFS2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AGO1_SCHPO | ago1 | genetic | 18818364 | |
ZDS1_SCHPO | zds1 | genetic | 18818364 | |
ASL1_SCHPO | asl1 | genetic | 22681890 | |
SEC7B_SCHPO | sec72 | genetic | 22681890 | |
RICTR_SCHPO | ste20 | genetic | 22681890 | |
YE98_SCHPO | erp2 | genetic | 22681890 | |
ATP11_SCHPO | atp11 | genetic | 22681890 | |
GMA12_SCHPO | gma12 | genetic | 22681890 | |
OMH6_SCHPO | omh6 | genetic | 22681890 | |
RRP1_SCHPO | nop52 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...