dbPTM

YF15_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YF15_SCHPO
UniProt AC	O14291
Protein Name	Uncharacterized protein C9E9.05
Gene Name	SPAC9E9.05
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	313
Subcellular Localization	Nucleus .
Protein Description
Protein Sequence	MDSDDSFVKTAHVIETSTPENKKLSHRFKSVEIVPPSSSNDDPFGFSSTKGIRLSSINSNDLVNTLSKGFNETSNMSYNRILPSSPPTLEIGEIDYNEALQIRSADENQQSVPTVSIASPSTPELPPSSSPLLPPNGSESSSPIPLSLLSTSSLQQRKITPSNLSNTSKPMDSKQLERLIPVPHGHHLTRLRKKRRRDDDIDLSGLYETKSSSPPAIHSDEDPSYSDSIARSPVKSAFNLRKRRKGVKEKKILKTYHSQDKDTASDNDNNTGSSDEENDNLKELTPGKKEYLKSIKKYFQDVDDYQLHVVNEG

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	KTAHVIETSTPENKK HHEEEEECCCCCCCC	27.12	24763107
17	Phosphorylation	TAHVIETSTPENKKL HEEEEECCCCCCCCC	29.22	24763107
18	Phosphorylation	AHVIETSTPENKKLS EEEEECCCCCCCCCC	41.88	21712547
37	Phosphorylation	SVEIVPPSSSNDDPF EEEECCCCCCCCCCC	40.09	25720772
38	Phosphorylation	VEIVPPSSSNDDPFG EEECCCCCCCCCCCC	38.65	25720772
55	Phosphorylation	STKGIRLSSINSNDL CCCCEEEHHCCCHHH	21.23	24763107
56	Phosphorylation	TKGIRLSSINSNDLV CCCEEEHHCCCHHHH	30.31	24763107
59	Phosphorylation	IRLSSINSNDLVNTL EEEHHCCCHHHHHHH	30.01	21712547
213	Phosphorylation	LYETKSSSPPAIHSD HEECCCCCCCCCCCC	41.83	28889911
219	Phosphorylation	SSPPAIHSDEDPSYS CCCCCCCCCCCCCCC	36.26	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YF15_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YF15_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YF15_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YF15_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YF15_SCHPO

Related Literatures of Post-Translational Modification