YEH7_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YEH7_YEAST
• UniProt AC: P39978
• Protein Name: Uncharacterized protein YEL067C
• Gene Name: YEL067C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 195
• Protein Sequence: MAFTTIRSLTIFSGSSFDMPTFFVLAKGGDGSGVFFISLHSSILYARFPLLNILSQHSPVYCSRRFPPDNDLITGLGNIRCGQLVKKALRRVCNVPPDHQLIASVRSIGYARVAFVFCTCTSECRDNLQSVTRTSGHQTTISQPCTDIQSTRKCSTIFVSAVMQTGTITFFWTFHFPIPLQRIVNQKQPPPQSYV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
130	Phosphorylation	ECRDNLQSVTRTSGH HHHHHHHHCEECCCC	28.73	29688323
132	Phosphorylation	RDNLQSVTRTSGHQT HHHHHHCEECCCCCC	33.21	29688323

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YEH7_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YEH7_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YEH7_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YEH7_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.