dbPTM

YE54_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YE54_SCHPO
UniProt AC	O14171
Protein Name	Dehydrodolichyl diphosphate synthase complex subunit SPAC4D7.04c {ECO:0000305}
Gene Name	SPAC4D7.04c
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	264
Subcellular Localization	Endoplasmic reticulum membrane Peripheral membrane protein .
Protein Description	With nus1, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER)..
Protein Sequence	MGNLSGWFIHCPPLQWTLDQLETMMINTIKRGKVPQHIAFVMDGNRRWARQRRMETIEGHSSGFEALKSLLKVCLKLGVKEVSAFTFSIENFKRSKYEVDMLMEIAKNSLTQITAHGDLVDQYGIRIRIVGDLSRLQPDVLETALKAVEITKHNTKATLNVCFPYTSRHEIATSVQSIVKMAEDGTITPEDIDEDIFEKNLLIKDSLPLDLLIRTSGVERLSDFMLWQCHKNTEIKFIDFYWPDFSIWKFFPMLIQYQLQNQPA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
186	Phosphorylation	VKMAEDGTITPEDID HHHHCCCCCCHHHCC	33.72	29996109
188	Phosphorylation	MAEDGTITPEDIDED HHCCCCCCHHHCCCC	22.06	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YE54_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YE54_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YE54_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YE54_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YE54_SCHPO

Related Literatures of Post-Translational Modification