UniProt ID | YE54_SCHPO | |
---|---|---|
UniProt AC | O14171 | |
Protein Name | Dehydrodolichyl diphosphate synthase complex subunit SPAC4D7.04c {ECO:0000305} | |
Gene Name | SPAC4D7.04c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 264 | |
Subcellular Localization |
Endoplasmic reticulum membrane Peripheral membrane protein . |
|
Protein Description | With nus1, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER).. | |
Protein Sequence | MGNLSGWFIHCPPLQWTLDQLETMMINTIKRGKVPQHIAFVMDGNRRWARQRRMETIEGHSSGFEALKSLLKVCLKLGVKEVSAFTFSIENFKRSKYEVDMLMEIAKNSLTQITAHGDLVDQYGIRIRIVGDLSRLQPDVLETALKAVEITKHNTKATLNVCFPYTSRHEIATSVQSIVKMAEDGTITPEDIDEDIFEKNLLIKDSLPLDLLIRTSGVERLSDFMLWQCHKNTEIKFIDFYWPDFSIWKFFPMLIQYQLQNQPA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YE54_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YE54_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YE54_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YE54_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...