UniProt ID | YDZ1_SCHPO | |
---|---|---|
UniProt AC | O13709 | |
Protein Name | Uncharacterized protein C14C4.01c | |
Gene Name | SPAC14C4.01c, SPAC19D5.08c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 244 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSSESKGIPIPRSDSNKTSDVSSWEEDYELISLGSSQDALQRSGIRSAHGDSGYASSPLRMEHLSSSTIIINNQLKKIDVNESIPENSTLHNKYELGAVESSTSSLSLLQSKEEDDSSNWETEDSESAVEEAELPTIFEGKTVISPSSSGTDHSEAVEYTVPTAPPIPDLRFQQSYLQSIQRANGSAFLVALITLRDHVLYPFLSGGMWVFVRHIFQFLKLQEKGFHFGQSLRRNLGLFSTFKD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | IPIPRSDSNKTSDVS CCCCCCCCCCCCCCC | 41.28 | 24763107 | |
56 | Phosphorylation | HGDSGYASSPLRMEH CCCCCCCCCCCCCCC | 24.81 | 29996109 | |
57 | Phosphorylation | GDSGYASSPLRMEHL CCCCCCCCCCCCCCC | 21.56 | 29996109 | |
145 | Phosphorylation | FEGKTVISPSSSGTD ECCCEEECCCCCCCC | 17.88 | 25720772 | |
147 | Phosphorylation | GKTVISPSSSGTDHS CCEEECCCCCCCCHH | 30.28 | 25720772 | |
149 | Phosphorylation | TVISPSSSGTDHSEA EEECCCCCCCCHHHE | 50.48 | 25720772 | |
151 | Phosphorylation | ISPSSSGTDHSEAVE ECCCCCCCCHHHEEE | 32.27 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YDZ1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YDZ1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YDZ1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YDZ1_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...