YDZ1_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YDZ1_SCHPO
• UniProt AC: O13709
• Protein Name: Uncharacterized protein C14C4.01c
• Gene Name: SPAC14C4.01c, SPAC19D5.08c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 244
• Protein Sequence: MSSESKGIPIPRSDSNKTSDVSSWEEDYELISLGSSQDALQRSGIRSAHGDSGYASSPLRMEHLSSSTIIINNQLKKIDVNESIPENSTLHNKYELGAVESSTSSLSLLQSKEEDDSSNWETEDSESAVEEAELPTIFEGKTVISPSSSGTDHSEAVEYTVPTAPPIPDLRFQQSYLQSIQRANGSAFLVALITLRDHVLYPFLSGGMWVFVRHIFQFLKLQEKGFHFGQSLRRNLGLFSTFKD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
15	Phosphorylation	IPIPRSDSNKTSDVS CCCCCCCCCCCCCCC	41.28	24763107
56	Phosphorylation	HGDSGYASSPLRMEH CCCCCCCCCCCCCCC	24.81	29996109
57	Phosphorylation	GDSGYASSPLRMEHL CCCCCCCCCCCCCCC	21.56	29996109
145	Phosphorylation	FEGKTVISPSSSGTD ECCCEEECCCCCCCC	17.88	25720772
147	Phosphorylation	GKTVISPSSSGTDHS CCEEECCCCCCCCHH	30.28	25720772
149	Phosphorylation	TVISPSSSGTDHSEA EEECCCCCCCCHHHE	50.48	25720772
151	Phosphorylation	ISPSSSGTDHSEAVE ECCCCCCCCHHHEEE	32.27	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YDZ1_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YDZ1_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YDZ1_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YDZ1_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.