YDR14_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YDR14_YEAST
• UniProt AC: Q04597
• Protein Name: Uncharacterized protein YDR114C
• Gene Name: YDR114C
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 100
• Protein Description: May be involved in growth at elevated pH and presence of calcium..
• Protein Sequence: MKTFFLIEAGRALQIVAFRPAITTVLFQRFSVSFSCSYFTCCTSQLLRENWLFKFLTAFDHVIRASNDLSTMRFMIMYIYVYIYIYTVLRKRLSCYMLIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
78	Phosphorylation	TMRFMIMYIYVYIYI HHHHHHHHHHHHHHH	4.34	28132839
80	Phosphorylation	RFMIMYIYVYIYIYT HHHHHHHHHHHHHHH	3.05	28132839
82	Phosphorylation	MIMYIYVYIYIYTVL HHHHHHHHHHHHHHH	3.22	28132839
84	Phosphorylation	MYIYVYIYIYTVLRK HHHHHHHHHHHHHHH	3.11	27017623
86	Phosphorylation	IYVYIYIYTVLRKRL HHHHHHHHHHHHHHH	3.62	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YDR14_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YDR14_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YDR14_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YDR14_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.