YDFF_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YDFF_SCHPO
• UniProt AC: Q10486
• Protein Name: Uncharacterized protein C17C9.15c
• Gene Name: SPAC17C9.15c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 94
• Protein Sequence: MSDSFHYQYDRASPERLKPTIYSWTRLRQSTRAQNENEQAKRRQGILEHKRGGSMEMNKFIDESAYMEWEKQLENASEDYAIEPSDLEEEVDQL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MSDSFHYQYDR ----CCCCCCCCCCC	13.45	29996109
9	Phosphorylation	SDSFHYQYDRASPER CCCCCCCCCCCCHHH	10.55	29996109
13	Phosphorylation	HYQYDRASPERLKPT CCCCCCCCHHHHCCH	28.34	29996109
54	Phosphorylation	LEHKRGGSMEMNKFI HHHHCCCCHHHHHHH	17.88	21712547
85	Phosphorylation	EDYAIEPSDLEEEVD CCCCCCHHHHHHHHH	41.88	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YDFF_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YDFF_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YDFF_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YDFF_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.