dbPTM

YDBI_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YDBI_SCHPO
UniProt AC	Q10368
Protein Name	Uncharacterized protein C22E12.18
Gene Name	SPAC22E12.18
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	336
Subcellular Localization
Protein Description
Protein Sequence	MSDTMVKNQAEEDEIVKSLNNVLKIVVTARKCLDDMKPIELPSELVESPLSMLKDVATLIHQYTTKLSVAAKPPITRDALEKYANDMATTITPLIAAVQVFNAEKYGEIIQNRLKMYAERVLFGIEALLRSVSPKPLGYISEDWKTRGRLIDTGILWESCEKIEKLGSEGIVGYMLEEWDNFVSMLEDARSDLEDYKEGDDSNWDDFGSESEDDSKEAHSEEVFRSEEQIQLANSLLQKLNACKILFLSIKKRRIKNEYPNTFLGELFNAAKQTSDSIDDIVAQIQEDDENFENELDNFHRSARNLCKICISSAQEDSFTPWFSKWLENWEIVSQK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
202	Phosphorylation	DYKEGDDSNWDDFGS HHHCCCCCCCCCCCC	44.56	29996109
209	Phosphorylation	SNWDDFGSESEDDSK CCCCCCCCCCCCCCH	37.63	24763107
211	Phosphorylation	WDDFGSESEDDSKEA CCCCCCCCCCCCHHH	48.28	28889911
220	Phosphorylation	DDSKEAHSEEVFRSE CCCHHHHHHHHHCCH	42.36	21712547
226	Phosphorylation	HSEEVFRSEEQIQLA HHHHHHCCHHHHHHH	33.74	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YDBI_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YDBI_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YDBI_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ATG11_SCHPO	atg11	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YDBI_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-211, AND MASSSPECTROMETRY.	18257517 [Abstract]