YD461_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YD461_YEAST
• UniProt AC: Q2V2P7
• Protein Name: Uncharacterized protein YDR461C-A
• Gene Name: YDR461C-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 80
• Protein Sequence: MDSGKSDINKHAYKETATPLPVDPPSYEETMKQDKEEVEADETTSSAHRDSFMRPVYTHHPHPRSHKGYPGAKTLTYTSR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MDSGKSDINK -----CCCCCCCCHH	46.99	30377154
6	Phosphorylation	--MDSGKSDINKHAY --CCCCCCCCHHHCC	47.45	30377154
16	Phosphorylation	NKHAYKETATPLPVD HHHCCCCCCCCCCCC	31.51	24961812
18	Phosphorylation	HAYKETATPLPVDPP HCCCCCCCCCCCCCC	32.55	24961812
35	Ubiquitination	EETMKQDKEEVEADE HHHHHHCHHHHHCCC	53.96	22106047
46	Phosphorylation	EADETTSSAHRDSFM HCCCCCCHHHHHHCC	26.46	28889911
67	Ubiquitination	HPHPRSHKGYPGAKT CCCCCCCCCCCCCEE	62.48	22817900
73	Ubiquitination	HKGYPGAKTLTYTSR CCCCCCCEECEEECC	50.40	23749301
73	Acetylation	HKGYPGAKTLTYTSR CCCCCCCEECEEECC	50.40	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YD461_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YD461_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YD461_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YD461_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.