| UniProt ID | YD461_YEAST | |
|---|---|---|
| UniProt AC | Q2V2P7 | |
| Protein Name | Uncharacterized protein YDR461C-A | |
| Gene Name | YDR461C-A | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 80 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MDSGKSDINKHAYKETATPLPVDPPSYEETMKQDKEEVEADETTSSAHRDSFMRPVYTHHPHPRSHKGYPGAKTLTYTSR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MDSGKSDINK -----CCCCCCCCHH | 46.99 | 30377154 | |
| 6 | Phosphorylation | --MDSGKSDINKHAY --CCCCCCCCHHHCC | 47.45 | 30377154 | |
| 16 | Phosphorylation | NKHAYKETATPLPVD HHHCCCCCCCCCCCC | 31.51 | 24961812 | |
| 18 | Phosphorylation | HAYKETATPLPVDPP HCCCCCCCCCCCCCC | 32.55 | 24961812 | |
| 35 | Ubiquitination | EETMKQDKEEVEADE HHHHHHCHHHHHCCC | 53.96 | 22106047 | |
| 46 | Phosphorylation | EADETTSSAHRDSFM HCCCCCCHHHHHHCC | 26.46 | 28889911 | |
| 67 | Ubiquitination | HPHPRSHKGYPGAKT CCCCCCCCCCCCCEE | 62.48 | 22817900 | |
| 73 | Ubiquitination | HKGYPGAKTLTYTSR CCCCCCCEECEEECC | 50.40 | 23749301 | |
| 73 | Acetylation | HKGYPGAKTLTYTSR CCCCCCCEECEEECC | 50.40 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YD461_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YD461_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YD461_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of YD461_YEAST !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...