YCHC_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YCHC_SCHPO
• UniProt AC: Q9Y7V1
• Protein Name: Uncharacterized protein C645.12c
• Gene Name: SPCC645.12c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 198
• Subcellular Localization: Nucleus .
• Protein Sequence: MSSARELLRKVKQERLGQKRGLKASSQELKRQKTRDHKSFENLGRDQSRELAVSDFNEKQSTEPPKDTRAVSALPENFFDESIAKNKELIEEEWNDFQNEIGIIEENAVEQEITLQQQQLLAEKDEENEIADNDLEPEVYDILYEEESKLGESRDLIRRLKQKRFETKKNNFSVKESSNLSNNDSDASLDEDTLLWGL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
39	Phosphorylation	QKTRDHKSFENLGRD HHCCCCHHHHHHCCH	34.08	24763107
54	Phosphorylation	QSRELAVSDFNEKQS HHHHHHHHCCCCCCC	30.77	21712547
68	Phosphorylation	STEPPKDTRAVSALP CCCCCCCCCHHHCCC	27.01	24763107
72	Phosphorylation	PKDTRAVSALPENFF CCCCCHHHCCCCCCC	24.09	25720772
178	Phosphorylation	NFSVKESSNLSNNDS CCCHHHCCCCCCCCC	42.77	21712547
181	Phosphorylation	VKESSNLSNNDSDAS HHHCCCCCCCCCCCC	37.53	21712547
185	Phosphorylation	SNLSNNDSDASLDED CCCCCCCCCCCCCCC	36.88	21712547
188	Phosphorylation	SNNDSDASLDEDTLL CCCCCCCCCCCCCHH	41.15	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YCHC_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YCHC_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YCHC_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YCHC_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.