UniProt ID | YCHC_SCHPO | |
---|---|---|
UniProt AC | Q9Y7V1 | |
Protein Name | Uncharacterized protein C645.12c | |
Gene Name | SPCC645.12c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 198 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MSSARELLRKVKQERLGQKRGLKASSQELKRQKTRDHKSFENLGRDQSRELAVSDFNEKQSTEPPKDTRAVSALPENFFDESIAKNKELIEEEWNDFQNEIGIIEENAVEQEITLQQQQLLAEKDEENEIADNDLEPEVYDILYEEESKLGESRDLIRRLKQKRFETKKNNFSVKESSNLSNNDSDASLDEDTLLWGL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | Phosphorylation | QKTRDHKSFENLGRD HHCCCCHHHHHHCCH | 34.08 | 24763107 | |
54 | Phosphorylation | QSRELAVSDFNEKQS HHHHHHHHCCCCCCC | 30.77 | 21712547 | |
68 | Phosphorylation | STEPPKDTRAVSALP CCCCCCCCCHHHCCC | 27.01 | 24763107 | |
72 | Phosphorylation | PKDTRAVSALPENFF CCCCCHHHCCCCCCC | 24.09 | 25720772 | |
178 | Phosphorylation | NFSVKESSNLSNNDS CCCHHHCCCCCCCCC | 42.77 | 21712547 | |
181 | Phosphorylation | VKESSNLSNNDSDAS HHHCCCCCCCCCCCC | 37.53 | 21712547 | |
185 | Phosphorylation | SNLSNNDSDASLDED CCCCCCCCCCCCCCC | 36.88 | 21712547 | |
188 | Phosphorylation | SNNDSDASLDEDTLL CCCCCCCCCCCCCHH | 41.15 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YCHC_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YCHC_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YCHC_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YCHC_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...