YC86_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YC86_SCHPO
• UniProt AC: O94596
• Protein Name: Putative uncharacterized membrane protein C622.06c
• Gene Name: SPCC622.06c
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 122
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MSPKESIELQEFQSLLQDEAYEELINKKTYEAIKYRSNDGILPIIITLFIFSFVISRMIIFFISLFNKNTYCELPAVADAIINSIALVCIIVILYFSSRKLNVEIRRGEVEDYRANLERNQR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSPKESIEL ------CCHHHHHHH	44.68	24763107
6	Phosphorylation	--MSPKESIELQEFQ --CCHHHHHHHHHHH	27.73	24763107
14	Phosphorylation	IELQEFQSLLQDEAY HHHHHHHHHHCHHHH	36.05	21712547
21	Phosphorylation	SLLQDEAYEELINKK HHHCHHHHHHHHCHH	14.11	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YC86_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YC86_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YC86_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YC86_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.