YC048_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YC048_YEAST
• UniProt AC: Q2V2Q2
• Protein Name: Uncharacterized protein YCL048W-A
• Gene Name: YCL048W-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 79
• Subcellular Localization: Cell membrane ; Lipid-anchor, GPI-anchor .
• Protein Sequence: MQIKNIVAVLATVTAINAQVGIEPNATTPNATQPNATQPNTTLPTASVTTTVSIGEAVVNTMAAGAFGAAIAAGVAFLF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
25	N-linked_Glycosylation	AQVGIEPNATTPNAT HHCCCCCCCCCCCCC	36.81	-
30	N-linked_Glycosylation	EPNATTPNATQPNAT CCCCCCCCCCCCCCC	54.23	-
35	N-linked_Glycosylation	TPNATQPNATQPNTT CCCCCCCCCCCCCCC	45.89	-
40	N-linked_Glycosylation	QPNATQPNTTLPTAS CCCCCCCCCCCCCCE	35.56	-
55	GPI-anchor	VTTTVSIGEAVVNTM EEEEEEHHHHHHHHH	14.87	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YC048_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YC048_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YC048_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YC048_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.