YC021_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YC021_YEAST
• UniProt AC: Q96VH3
• Protein Name: Putative uncharacterized protein YCL021W-A
• Gene Name: YCL021W-A
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 125
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MVLTDAEELRSPVITSDMSFFDLESNHSSDSVHLLCEKYTHKLPIESESQTTFRLAPTKQRLYRQSTLYVPLSLKQRVFLFTERVKSIWAGLPRCKPNKYFKVAFALAVLTPLAIWIFYIDFRVH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YC021_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YC021_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YC021_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YC021_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HIS9_YEAST	HIS2	physical	18467557
SIR1_YEAST	SIR1	physical	18467557
ITC1_YEAST	ITC1	physical	18467557
HDA3_YEAST	HDA3	physical	18467557
SEC62_YEAST	SEC62	physical	18719252

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.