UniProt ID | YBWC_SCHPO | |
---|---|---|
UniProt AC | O94670 | |
Protein Name | Uncharacterized protein C651.12c | |
Gene Name | SPBC651.12c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 273 | |
Subcellular Localization | Nucleus . Cytoplasm, cytoskeleton, spindle . | |
Protein Description | ||
Protein Sequence | MSSKKVKYNPRKSASQNEATSASAGSKAFGFNSAKKEKLHRMALSMEAIEDVEDQSFNGKSSNLVRKRRGLDEDIDEFSSSSEDERKPARHPQSSSQKPFASSTYNVELPTSPTKITNIGQSSPRALRYLSPESQRIKNAKMKSPISTHLAKYSIHHMGTPPSKPSFLSSSVSSPASSKQKSLFQCTKDLEKRYINRVHRSSETELVQLSSIKVLDRFLSDIYLVEAEKNEEKCTVLLLKRSNTDVDNSSSLSLTLPLCKFTKNGHQVHIHPC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
102 | Phosphorylation | SSQKPFASSTYNVEL CCCCCCCCCEEEEEC | 24.48 | 21712547 | |
111 | Phosphorylation | TYNVELPTSPTKITN EEEEECCCCCCCCEE | 61.02 | 21712547 | |
112 | Phosphorylation | YNVELPTSPTKITNI EEEECCCCCCCCEEC | 28.74 | 21712547 | |
122 | Phosphorylation | KITNIGQSSPRALRY CCEECCCCCHHHHHH | 36.78 | 21712547 | |
123 | Phosphorylation | ITNIGQSSPRALRYL CEECCCCCHHHHHHC | 15.54 | 28889911 | |
129 | Phosphorylation | SSPRALRYLSPESQR CCHHHHHHCCHHHHH | 16.63 | 29996109 | |
131 | Phosphorylation | PRALRYLSPESQRIK HHHHHHCCHHHHHHH | 20.07 | 28889911 | |
134 | Phosphorylation | LRYLSPESQRIKNAK HHHCCHHHHHHHHCC | 28.30 | 21712547 | |
144 | Phosphorylation | IKNAKMKSPISTHLA HHHCCCCCCHHHHHH | 24.78 | 24763107 | |
147 | Phosphorylation | AKMKSPISTHLAKYS CCCCCCHHHHHHHHH | 17.10 | 25720772 | |
148 | Phosphorylation | KMKSPISTHLAKYSI CCCCCHHHHHHHHHH | 22.94 | 21712547 | |
170 | Phosphorylation | SKPSFLSSSVSSPAS CCCCCCCCCCCCCCC | 36.59 | 24763107 | |
174 | Phosphorylation | FLSSSVSSPASSKQK CCCCCCCCCCCHHHH | 23.48 | 24763107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBWC_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBWC_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBWC_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
REB1_SCHPO | reb1 | genetic | 22681890 | |
RAD55_SCHPO | rad55 | genetic | 22681890 | |
SWD1_SCHPO | swd1 | genetic | 22681890 | |
TOM70_SCHPO | tom70 | genetic | 22681890 | |
NPY1_SCHPO | SPBC1778.03c | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...