UniProt ID | YBD4_SCHPO | |
---|---|---|
UniProt AC | O42928 | |
Protein Name | Uncharacterized protein C16C6.04 | |
Gene Name | SPBC16C6.04 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 350 | |
Subcellular Localization | Nucleus . | |
Protein Description | ||
Protein Sequence | MDSFHPTPGKPTTATSNSSLNFFVRNREKSIRCSSLHQTFTAPSPEASPSIGLRYVNYSMSDETDESMFPLDSELTDMEDDDTEYISDSTTDLPSAAMARGTRQLSYNENLDQRSFSKTPNKHIEVKNLKDLCSPSHSGRISKSLCPVLRRKSLLPKPKMFQRVASALYEESSPLELEIRSESEFSKMFFEPKKSSSFVSRAASPAMVGPGVPFYSSITGANGNVLAPSGSLKAVENSDVIESSAEDSSNTDNPSTKPSNEMPISPLLSSSVFFKDTEMSTPNSNHSRSRTPSSKKRTRWGEEIIDLSKRRAVSPSIYYDLDKKCSPIHSVMVSPLKIKDTHEVLMNLKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
44 | Phosphorylation | HQTFTAPSPEASPSI CEEEECCCCCCCCCC | 32.67 | 25720772 | |
48 | Phosphorylation | TAPSPEASPSIGLRY ECCCCCCCCCCEEEE | 19.95 | 25720772 | |
134 | Phosphorylation | KNLKDLCSPSHSGRI CCHHHHCCCCCCCCC | 36.41 | 21712547 | |
314 | Phosphorylation | LSKRRAVSPSIYYDL HHHHCCCCHHHHHCC | 16.37 | 25720772 | |
326 | Phosphorylation | YDLDKKCSPIHSVMV HCCCCCCCCCCEEEE | 35.45 | 21712547 | |
334 | Phosphorylation | PIHSVMVSPLKIKDT CCCEEEECCCCCCCH | 13.35 | 21712547 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBD4_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBD4_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBD4_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YBD4_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...