YBD4_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YBD4_SCHPO
• UniProt AC: O42928
• Protein Name: Uncharacterized protein C16C6.04
• Gene Name: SPBC16C6.04
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 350
• Subcellular Localization: Nucleus .
• Protein Sequence: MDSFHPTPGKPTTATSNSSLNFFVRNREKSIRCSSLHQTFTAPSPEASPSIGLRYVNYSMSDETDESMFPLDSELTDMEDDDTEYISDSTTDLPSAAMARGTRQLSYNENLDQRSFSKTPNKHIEVKNLKDLCSPSHSGRISKSLCPVLRRKSLLPKPKMFQRVASALYEESSPLELEIRSESEFSKMFFEPKKSSSFVSRAASPAMVGPGVPFYSSITGANGNVLAPSGSLKAVENSDVIESSAEDSSNTDNPSTKPSNEMPISPLLSSSVFFKDTEMSTPNSNHSRSRTPSSKKRTRWGEEIIDLSKRRAVSPSIYYDLDKKCSPIHSVMVSPLKIKDTHEVLMNLKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
44	Phosphorylation	HQTFTAPSPEASPSI CEEEECCCCCCCCCC	32.67	25720772
48	Phosphorylation	TAPSPEASPSIGLRY ECCCCCCCCCCEEEE	19.95	25720772
134	Phosphorylation	KNLKDLCSPSHSGRI CCHHHHCCCCCCCCC	36.41	21712547
314	Phosphorylation	LSKRRAVSPSIYYDL HHHHCCCCHHHHHCC	16.37	25720772
326	Phosphorylation	YDLDKKCSPIHSVMV HCCCCCCCCCCEEEE	35.45	21712547
334	Phosphorylation	PIHSVMVSPLKIKDT CCCEEEECCCCCCCH	13.35	21712547

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YBD4_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YBD4_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YBD4_SCHPO !!

Protein-Protein Interaction

Oops, there are no PPI records of YBD4_SCHPO !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.