UniProt ID | YBA9_SCHPO | |
---|---|---|
UniProt AC | O42901 | |
Protein Name | Uncharacterized protein C119.09c | |
Gene Name | SPBC119.09c | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 186 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MGSSSSRRRSSSLVTKVPKPTIDDRLDQGSATNYNSNWVNYKGAWVIHIVLIAALRLIFHAIPSVSRELAWTLTNLTYMAGSFIMFHWVTGTPFEFNGGAYDRLTMWEQLDEGNQYTPARKYLLVLPIILFLMSTHYTHYNGWMFLVNIWALFMVLIPKLPAVHRKRIFGIQKLSLRDDDNDSIPR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | SSSSRRRSSSLVTKV CCCCCCCCCCCCCCC | 23.59 | 29996109 | |
11 | Phosphorylation | SSSRRRSSSLVTKVP CCCCCCCCCCCCCCC | 26.36 | 25720772 | |
12 | Phosphorylation | SSRRRSSSLVTKVPK CCCCCCCCCCCCCCC | 28.27 | 28889911 | |
15 | Phosphorylation | RRSSSLVTKVPKPTI CCCCCCCCCCCCCCC | 31.45 | 29996109 | |
175 | Phosphorylation | IFGIQKLSLRDDDND HCCEEECCCCCCCCC | 28.52 | 21712547 | |
183 | Phosphorylation | LRDDDNDSIPR---- CCCCCCCCCCC---- | 40.52 | 24763107 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YBA9_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YBA9_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YBA9_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YBA9_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...