UniProt ID | YAP1_CHICK | |
---|---|---|
UniProt AC | P46936 | |
Protein Name | Transcriptional coactivator YAP1 | |
Gene Name | YAP1 | |
Organism | Gallus gallus (Chicken). | |
Sequence Length | 448 | |
Subcellular Localization | Cytoplasm . Nucleus . Both phosphorylation and cell density can regulate its subcellular localization. Phosphorylation sequesters it in the cytoplasm by inhibiting its translocation into the nucleus. At low density, predominantly nuclear and is trans | |
Protein Description | Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis (By similarity). Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation (By similarity).. | |
Protein Sequence | MDPGQPQPQQPPQAAQPPAPQQAAPQPPGAGSGAPGGAAQPPGAGPPPAGHQIVHVRGDSETDLEALFNAVMNPKGANVPHTLPMRLRKLPDSFFKPPEPKAHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPSGVVTGPGAPSSQHLRQSSFEIPDDVPLPPGWEMAKTPSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNLMNSASAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSSSNQQQQMRLQQLQMEKERLRLKHQELLRQELALRSQLPTMEQDGGSQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDSISQSNIPSHQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKPDKESFLTWL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
62 | Phosphorylation | HVRGDSETDLEALFN EECCCCHHHHHHHHH | 50.24 | 23106611 | |
108 | Phosphorylation | KAHSRQASTDAGTAG CCCCCCCCCCCCCCC | 20.62 | 23106611 | |
109 | Phosphorylation | AHSRQASTDAGTAGA CCCCCCCCCCCCCCC | 32.65 | 23106611 | |
113 | Phosphorylation | QASTDAGTAGALTPQ CCCCCCCCCCCCCHH | 24.52 | 23106611 | |
130 | Phosphorylation | RAHSSPASLQLGAVS HCCCCCCEEECCCCC | 21.74 | 23106611 | |
311 | Phosphorylation | GSQNPVSSPGMSQEL CCCCCCCCCCCCHHH | 26.21 | 23106611 | |
326 | Phosphorylation | RTMTTNSSDPFLNSG HHHCCCCCCCCCCCC | 51.91 | 23106611 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YAP1_CHICK !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YAP1_CHICK !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YAP1_CHICK !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of YAP1_CHICK !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...