YAP1_CHICK - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YAP1_CHICK
• UniProt AC: P46936
• Protein Name: Transcriptional coactivator YAP1
• Gene Name: YAP1
• Organism: Gallus gallus (Chicken).
• Sequence Length: 448
• Subcellular Localization: Cytoplasm . Nucleus . Both phosphorylation and cell density can regulate its subcellular localization. Phosphorylation sequesters it in the cytoplasm by inhibiting its translocation into the nucleus. At low density, predominantly nuclear and is trans
• Protein Description: Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis (By similarity). Plays a key role in tissue tension and 3D tissue shape by regulating cortical actomyosin network formation (By similarity)..
• Protein Sequence: MDPGQPQPQQPPQAAQPPAPQQAAPQPPGAGSGAPGGAAQPPGAGPPPAGHQIVHVRGDSETDLEALFNAVMNPKGANVPHTLPMRLRKLPDSFFKPPEPKAHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPSGVVTGPGAPSSQHLRQSSFEIPDDVPLPPGWEMAKTPSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNLMNSASAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSSSNQQQQMRLQQLQMEKERLRLKHQELLRQELALRSQLPTMEQDGGSQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDSISQSNIPSHQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKPDKESFLTWL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	Phosphorylation	HVRGDSETDLEALFN EECCCCHHHHHHHHH	50.24	23106611
108	Phosphorylation	KAHSRQASTDAGTAG CCCCCCCCCCCCCCC	20.62	23106611
109	Phosphorylation	AHSRQASTDAGTAGA CCCCCCCCCCCCCCC	32.65	23106611
113	Phosphorylation	QASTDAGTAGALTPQ CCCCCCCCCCCCCHH	24.52	23106611
130	Phosphorylation	RAHSSPASLQLGAVS HCCCCCCEEECCCCC	21.74	23106611
311	Phosphorylation	GSQNPVSSPGMSQEL CCCCCCCCCCCCHHH	26.21	23106611
326	Phosphorylation	RTMTTNSSDPFLNSG HHHCCCCCCCCCCCC	51.91	23106611

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YAP1_CHICK !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YAP1_CHICK !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YAP1_CHICK !!

Protein-Protein Interaction

Oops, there are no PPI records of YAP1_CHICK !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.