YAGC_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YAGC_SCHPO
• UniProt AC: Q09875
• Protein Name: Uncharacterized protein C12G12.12
• Gene Name: SPAC12G12.12
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 324
• Subcellular Localization: Membrane ; Multi-pass membrane protein .
• Protein Sequence: MLLPIIMLTSGVANTVLSKYQDSIAEESEPIKSMAVLQSLNIFLGEACLWFYVLYKRHSQGPGYESLDHLPLKHKVFMALPAIMDICGSTLMNVGLLYTSASIYQMTRGSLIIFVALFATTLLKRTIGQLQWLSLSFVVLGVAIVGYSGSSSSIGSNPILGITAVLIGQFFLATQFTIEEYILSFIQVDPSELVAYEGTYGVFFVLLGMIISYYFIGSTTAGYHGWFDYSHVISRFNEVPALYVISGVILVSIAFFNVSGLAITKLHSATTRSLLDIARTFGIWIIAMAMGMESFHLLQFLGFVLLIYGIFTYHSIIKFPLAES

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of YAGC_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YAGC_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YAGC_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YAGC_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MUG61_SCHPO	man1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.