dbPTM

YA36_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YA36_SCHPO
UniProt AC	Q09713
Protein Name	Uncharacterized protein C18B11.06
Gene Name	SPAC18B11.06
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	327
Subcellular Localization
Protein Description
Protein Sequence	MDVLNKSIQTALEALPKTSSSSSDGVSLVSLKCQLLLSYVQKLAFLMLVKLDDESFLQHQDVVEKLVQLRIEIEKIRPLENRIQYSVDKLLRAAGRKEEIGSIKEPENNGNDKDSQDSLKLHYKPNLSEFADDSDGPASENNVVKEDDKSSISSEDEEEELRSAKDGIYRPPRIRAVTMDSEKRTRHRPNHLVDEFVSSDMSSVPQSMPSVGSNLEKRGRVIHADERELQKMRERIEYEESNYTRLPKLSKKDLKKSKRVKKHDYGGEDWSLLDRKFHDDDFSNRKLDLTSRAKRRANFEDVNDGSLASPVQIGQSYRKRKKNLKRR

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MDVLNKSIQTALEA -CCHHHHHHHHHHHH	20.89	25720772
102	Phosphorylation	GRKEEIGSIKEPENN CCHHHCCCCCCCCCC	35.83	24763107
115	Phosphorylation	NNGNDKDSQDSLKLH CCCCCCCCCHHHHHH	41.44	21712547
118	Phosphorylation	NDKDSQDSLKLHYKP CCCCCCHHHHHHCCC	21.55	24763107
123	Phosphorylation	QDSLKLHYKPNLSEF CHHHHHHCCCCHHHH	38.28	21712547
128	Phosphorylation	LHYKPNLSEFADDSD HHCCCCHHHHCCCCC	36.99	21712547
134	Phosphorylation	LSEFADDSDGPASEN HHHHCCCCCCCCCCC	45.04	28889911
139	Phosphorylation	DDSDGPASENNVVKE CCCCCCCCCCCCCCC	43.95	21712547
153	Phosphorylation	EDDKSSISSEDEEEE CCCCCCCCCHHHHHH	29.62	28889911
154	Phosphorylation	DDKSSISSEDEEEEL CCCCCCCCHHHHHHH	47.61	28889911
306	Phosphorylation	FEDVNDGSLASPVQI CCCCCCCCCCCHHHH	24.51	21712547
309	Phosphorylation	VNDGSLASPVQIGQS CCCCCCCCHHHHCHH	30.78	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YA36_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YA36_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YA36_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of YA36_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YA36_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-153; SER-154 ANDSER-309, AND MASS SPECTROMETRY.	18257517 [Abstract]