Y5902_DROME - dbPTM
Y5902_DROME - PTM Information in dbPTM
Basic Information of Protein
UniProt ID Y5902_DROME
UniProt AC Q9VCF0
Protein Name Uncharacterized protein CG5902
Gene Name CG5902
Organism Drosophila melanogaster (Fruit fly).
Sequence Length 243
Subcellular Localization
Protein Description
Protein Sequence MSNSHYNNYQQQQPHSSNGDPEYQHQQMVHQPQRFSNGHGMKTVAVPDMCLFCFEVLDCELNNVDGPSVPVFSNDAYPLFVTWKIGRDKRLRGCIGTFSAMELHHGLREYALTSAFKDSRFAPISRDELPRLTVSVSILQNFEEAQGHLDWQLGVHGIRIEFLTERGCKRTATYLPQVATEQGWDQLQTIDSLLRKGGYRAAITPETRKSIKLTRYRSQEIQMHYKEYREYQERRAQFGKVQC
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster
125PhosphorylationDSRFAPISRDELPRL
CCCCCCCCHHHCCCE
32.4022817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of Y5902_DROME !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of Y5902_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of Y5902_DROME !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of Y5902_DROME !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of Y5902_DROME

loading...

Related Literatures of Post-Translational Modification

TOP