Y5475_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: Y5475_ARATH
• UniProt AC: Q680D9
• Protein Name: B3 domain-containing protein At5g25475
• Gene Name: At5g25475
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 282
• Subcellular Localization: Nucleus .
• Protein Sequence: MLPKNAIEKIQANVSKPCFWKSLSPGQTWKSKSMRIIPEDFVRRTRGAFEHRVVFSVRWENSWQLWLEREKNELFMIEEDWNEFVDDNHLGPNDNLFIKHDETMNLEVQIFKNNGVEIIDVPLGVEPETEPFHPTPKKPHKETTPASSFASGSGCSANGGTNGRGKQRSSDVKNPERYLLNPENPYFVQAVTKRNDVLYVSRPVVQSYRLKFGPVKSTITYLLPGEKKEEGENRIYNGKPCFSGWSVLCRRHNLNIGDSVVCELERSGGVVTAVRVHFVKKD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
31	Phosphorylation	SPGQTWKSKSMRIIP CCCCCCCCCCEEECC	22.86	24894044
33	Phosphorylation	GQTWKSKSMRIIPED CCCCCCCCEEECCHH	22.00	24894044
201	Phosphorylation	RNDVLYVSRPVVQSY CCCEEEEECCEEEEE	19.81	19880383
207	Phosphorylation	VSRPVVQSYRLKFGP EECCEEEEEEEECCC	10.70	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of Y5475_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of Y5475_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of Y5475_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of Y5475_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.