| UniProt ID | Y5224_ARATH | |
|---|---|---|
| UniProt AC | Q94EG6 | |
| Protein Name | Uncharacterized protein At5g02240 | |
| Gene Name | At5g02240 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 253 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MANLPTVLVTGASGRTGQIVYKKLKEGSDKFVAKGLVRSAQGKEKIGGEADVFIGDITDADSINPAFQGIDALVILTSAVPKMKPGFDPTKGGRPEFIFEDGQYPEQVDWIGQKNQIDAAKVAGVKHIVVVGSMGGTNPDHPLNKLGNGNILVWKRKAEQYLADSGTPYTIIRAGGLLDKEGGVRELLVGKDDELLQTDTKTVPRADVAEVCIQALLFEEAKNKAFDLGSKPEGTSTPTKDFKALFSQVTSRF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MANLPTVLV ------CCCCCEEEE | 26.68 | 22223895 | |
| 83 | Sulfoxidation | LTSAVPKMKPGFDPT HHCCCCCCCCCCCCC | 5.32 | 25693801 | |
| 133 | Phosphorylation | KHIVVVGSMGGTNPD CEEEEEECCCCCCCC | 11.57 | 25561503 | |
| 134 | Sulfoxidation | HIVVVGSMGGTNPDH EEEEEECCCCCCCCC | 4.76 | 25693801 | |
| 230 | Phosphorylation | NKAFDLGSKPEGTST HCCCCCCCCCCCCCC | 52.95 | 23776212 | |
| 235 | Phosphorylation | LGSKPEGTSTPTKDF CCCCCCCCCCCCHHH | 27.97 | 23776212 | |
| 236 | Phosphorylation | GSKPEGTSTPTKDFK CCCCCCCCCCCHHHH | 43.15 | 23776212 | |
| 237 | Phosphorylation | SKPEGTSTPTKDFKA CCCCCCCCCCHHHHH | 34.51 | 23776212 | |
| 239 | Phosphorylation | PEGTSTPTKDFKALF CCCCCCCCHHHHHHH | 43.25 | 23776212 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of Y5224_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of Y5224_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of Y5224_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of Y5224_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks."; Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.; Plant Physiol. 150:889-903(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-237, AND MASSSPECTROMETRY. | |