Y5161_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: Y5161_ARATH
• UniProt AC: Q9M015
• Protein Name: Uncharacterized protein At5g01610
• Gene Name: At5g01610
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 170
• Protein Sequence: MDQIFNKVGSYWLGQKANKQFDSVGNDLNSVSTSIEGGTKWLVNKIKGKMQKPLPELLKEYDLPIGIFPGDATNYEFDEETKKLTVLIPSICEVGYKDSSVLKFTTTVTGHLEKGKLTDVEGIKTKVMIWVKVTSISTDASKVYFTAGMKKSRSRDAYEVQRNGLRVDKF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Phosphorylation	KANKQFDSVGNDLNS HHHHCCCCCCCCHHH	32.96	30407730
30	Phosphorylation	SVGNDLNSVSTSIEG CCCCCHHHCEEEECC	25.41	30407730
32	Phosphorylation	GNDLNSVSTSIEGGT CCCHHHCEEEECCCH	19.09	30407730
33	Phosphorylation	NDLNSVSTSIEGGTK CCHHHCEEEECCCHH	31.41	30407730
34	Phosphorylation	DLNSVSTSIEGGTKW CHHHCEEEECCCHHH	15.90	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of Y5161_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of Y5161_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of Y5161_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of Y5161_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.