Y4844_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: Y4844_ARATH
• UniProt AC: O49453
• Protein Name: Uncharacterized protein At4g28440
• Gene Name: At4g28440
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 153
• Protein Sequence: MATTGTAAVATGTSTVKRKPVFVKVEQLKPGTTGHTLTVKVIEANIVVPVTRKTRPASSLSRPSQPSRIVECLIGDETGCILFTARNDQVDLMKPGATVILRNSRIDMFKGTMRLGVDKWGRIEATGAASFTVKEDNNLSLVEYELINVGGDQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MATTGTAAV ------CCCCCCEEE	17.54	22223895
13	Phosphorylation	TAAVATGTSTVKRKP CEEEECCCCCCCCCC	19.50	19880383
14	Phosphorylation	AAVATGTSTVKRKPV EEEECCCCCCCCCCE	32.33	19880383
113	Sulfoxidation	IDMFKGTMRLGVDKW CCCCCCEEEECCCCC	4.54	25693801

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of Y4844_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of Y4844_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of Y4844_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HS157_ARATH	AT5G37670	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.