UniProt ID | Y4844_ARATH | |
---|---|---|
UniProt AC | O49453 | |
Protein Name | Uncharacterized protein At4g28440 | |
Gene Name | At4g28440 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 153 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MATTGTAAVATGTSTVKRKPVFVKVEQLKPGTTGHTLTVKVIEANIVVPVTRKTRPASSLSRPSQPSRIVECLIGDETGCILFTARNDQVDLMKPGATVILRNSRIDMFKGTMRLGVDKWGRIEATGAASFTVKEDNNLSLVEYELINVGGDQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MATTGTAAV ------CCCCCCEEE | 17.54 | 22223895 | |
13 | Phosphorylation | TAAVATGTSTVKRKP CEEEECCCCCCCCCC | 19.50 | 19880383 | |
14 | Phosphorylation | AAVATGTSTVKRKPV EEEECCCCCCCCCCE | 32.33 | 19880383 | |
113 | Sulfoxidation | IDMFKGTMRLGVDKW CCCCCCEEEECCCCC | 4.54 | 25693801 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of Y4844_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of Y4844_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of Y4844_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HS157_ARATH | AT5G37670 | physical | 21798944 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...