dbPTM

Y3380_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	Y3380_DROME
UniProt AC	Q9VVR0
Protein Name	Uncharacterized protein CG13380
Gene Name	CG13380
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	169
Subcellular Localization
Protein Description
Protein Sequence	MPFANEGNDPIAARLSKCYWNLSSPFLKDVIPKKRPSKAFNRKPPTKLESEEEEYHKFERGLHISDLGPKLKETDGQPKLKFELADDYKSSKHCICMRSNTAYECERCHQYFYGRLAQICDLHPNEFFLMDFRNCPFCKAPIEMIKKSPISWETIRKIEEAELPSDGDL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
165	Phosphorylation	IEEAELPSDGDL--- HHHCCCCCCCCC---	67.84	19060867

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of Y3380_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of Y3380_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of Y3380_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of Y3380_DROME !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of Y3380_DROME

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"An integrated chemical, mass spectrometric and computational strategyfor (quantitative) phosphoproteomics: application to Drosophilamelanogaster Kc167 cells."; Bodenmiller B., Mueller L.N., Pedrioli P.G.A., Pflieger D.,Juenger M.A., Eng J.K., Aebersold R., Tao W.A.; Mol. Biosyst. 3:275-286(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-165, AND MASSSPECTROMETRY.	17372656 [Abstract]