Y2010_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: Y2010_ARATH
• UniProt AC: P0C895
• Protein Name: LRR repeats and ubiquitin-like domain-containing protein At2g30105
• Gene Name: At2g30105
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 374
• Protein Sequence: MELEDPTMADSTIKLTVKFGGKSIPLSVSPDCTVKDLKSQLQPITNVLPRGQKLIFKGKVLVETSTLKQSDVGSGAKLMLMASQGLHQGEGPILKEASIRPISRTVVSDKVDQRKPSVLVDKNRTDRWKATGVIALAQANLKEIPEEVWDCGSGVRVLDISENFIKEVPAKISSFGSMQKLFLQGNGLSDESIQWEGIASLKRLMLLSISHNNLTVLPSAMGSLTSLRQLDVTNNKLTSLPNELGLLTQLEILKANNNRITSLPESIGNCSFLMEVDLSANIISELPETFTKLRNLKTLELNNTGLKTLPSALFKMCLQLSTLGLHNTEITVEFLRQFEGYDDFDERRRTKHQKQLDFRVVGSGQFDEGADKSW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
174	Phosphorylation	EVPAKISSFGSMQKL HCCCCHHHCHHHHHH	36.78	24043427
363	Phosphorylation	LDFRVVGSGQFDEGA CCEEEECCCCCCCCC	20.15	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of Y2010_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of Y2010_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of Y2010_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of Y2010_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.