dbPTM

Y1648_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	Y1648_ARATH
UniProt AC	Q6NLC8
Protein Name	Uncharacterized protein At1g66480
Gene Name	At1g66480
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	225
Subcellular Localization
Protein Description
Protein Sequence	MGNSITVKRKRAKVMKIDGETFRIKTPVTAREVTADYPGYVLLDSQAVKHFGVRSKPLEPNQTLKPKKTYFLVELPKLPPETTAVDTENKLPYRRVMSGIHVGAKERLDMLMLSRRTVSDVTIGRSDGGDGFGPELGPGHTSVRLRLPRSQITKLMEENNNDASAIAEKILGIYMERSGELGGGRGGVDGRRELGSGEIKAREKQVSFAGEGGRELPVLWSRSGK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MGNSITVKRKR ----CCCCEEEEECC	17.57	28011693
6	Phosphorylation	--MGNSITVKRKRAK --CCCCEEEEECCCE	21.57	28011693
98	Phosphorylation	LPYRRVMSGIHVGAK CCHHHHHCCCCCCHH	31.57	17317660
114	Phosphorylation	RLDMLMLSRRTVSDV HHHHHHHCCCCCCCE	13.02	17586839
117	Phosphorylation	MLMLSRRTVSDVTIG HHHHCCCCCCCEEEC	24.21	25561503
119	Phosphorylation	MLSRRTVSDVTIGRS HHCCCCCCCEEECCC	26.25	17317660
122	Phosphorylation	RRTVSDVTIGRSDGG CCCCCCEEECCCCCC	23.78	25561503
156	Sulfoxidation	RSQITKLMEENNNDA HHHHHHHHHHCCCCH	6.91	23289948
207	Phosphorylation	KAREKQVSFAGEGGR EEEEEEEEECCCCCC	13.59	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of Y1648_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of Y1648_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of Y1648_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of Y1648_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of Y1648_ARATH

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Quantitative phosphoproteomics of early elicitor signaling inArabidopsis."; Benschop J.J., Mohammed S., O'Flaherty M., Heck A.J.R., Slijper M.,Menke F.L.H.; Mol. Cell. Proteomics 6:1198-1214(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-119, AND MASSSPECTROMETRY.	17317660 [Abstract]
"Temporal analysis of sucrose-induced phosphorylation changes inplasma membrane proteins of Arabidopsis."; Niittylae T., Fuglsang A.T., Palmgren M.G., Frommer W.B.,Schulze W.X.; Mol. Cell. Proteomics 6:1711-1726(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-114, AND MASSSPECTROMETRY.	17586839 [Abstract]